Escherichia coli (E. coli) strains can harbor plasmids encoding colicins, which are toxins that kill other bacteria by forming pores in the cytoplasmic membrane, thus dissipating the membrane potential . To protect themselves from their own colicins, these E. coli strains produce immunity proteins. The recombinant Colicin-B immunity protein (Cbi) is a specific immunity protein that protects E. coli from colicin B . Cbi is a transmembrane protein found in the cytoplasmic membrane, where it inactivates colicin B, preventing it from forming pores and disrupting the membrane potential .
The Cbi protein is composed of 175 amino acids . The molecular weight of the protein, determined electrophoretically, is approximately 20,000 Da, which aligns with its calculated molecular weight of 20,185 Da . The protein contains four large hydrophobic regions, which facilitate its integration into the cytoplasmic membrane .
The amino acid sequence of Cbi is homologous to that of colicin A immunity protein . The sequence of E. coli Colicin-B immunity protein (cbi) is :
MTSNKDKNKKANEILYAFSIIGIIPLMAILILRINDPYSQVLYYLYNKVAFLPSITSL
HDPVMTTLMSNYNKTAPVMGILVFLCTYKTREIIKPVTRKLVVQSCFWGPVFYAILI
YITLFYNLELTTAGGFFKLLSHNVITLFILYCSIYFTVLTMTYAILLMPLLVIKYFKGRQ
Cbi functions by interacting with hydrophobic transmembrane helices of the corresponding colicin channel within the lipid bilayer core . Cbi prevents colicin B from killing the host cell . Specifically, Cbi inactivates the colicin in the cytoplasmic membrane, thus preventing pore formation and maintaining the membrane potential .
Cbi can be produced through recombinant DNA technology in E. coli, yeast, baculovirus, or mammalian cells . Recombinant Cbi protein is useful for vaccine development, and is for research purposes only .
Studies involving the exchange of hydrophilic loops between colicin A and B immunity proteins, construction of Cbi/Cai hybrids, and production of Cai as two fragments have revealed high structural constraints for the function of these proteins . The periplasmic loops of Cai and Cbi do not carry the determinants for colicin recognition, though most of these loops are required for Cai function . The cytoplasmic loop of Cai is involved in topology and function of Cai. The immunity function is not confined to a particular region of the immunity proteins .
This protein confers protection against colicin B to cells harboring the ColB plasmid encoding colicin B.
The Colicin B immunity protein (Cbi) is an integral membrane protein that protects colicin-producing E. coli cells from self-killing by the pore-forming colicin B. It functions by interacting with the hydrophobic transmembrane helices of colicin B within the lipid bilayer core, thereby preventing the formation of lethal pores in the cytoplasmic membrane that would otherwise dissipate the membrane potential . Cbi is encoded by the cbi locus on plasmids and enables cells harboring this genetic element to be immune to the cytotoxic effects of colicin B .
Cbi is a polypeptide consisting of 175 amino acids with a molecular weight of approximately 20,000 Da (electrophoretically determined) or 20,185 Da (calculated from sequence) . The protein contains four large hydrophobic regions that facilitate its integration into the membrane . Cbi shares significant amino acid sequence homology with the colicin A immunity protein (Cai), reflecting their similar functions and suggesting a common evolutionary origin .
Localization studies have definitively shown that Cbi is primarily contained within the cytoplasmic membrane fraction of E. coli cells . This membrane localization is critical for its function, as it allows direct interaction with and neutralization of colicin B in the site where the colicin would otherwise form its lethal pore . The protein's integration into the membrane is facilitated by its hydrophobic regions, with specific topology that positions it to interact effectively with the invading colicin .
The cbi gene is typically found on self-transmissible plasmids rather than on the chromosome . Genomic analyses show that the cbi immunity gene is invariably transcribed in the opposite direction to the cba (colicin B activity) gene . Interestingly, colicin B genes are frequently co-occurrent with colicin M genes at frequencies greater than expected by chance, with their respective immunity genes (cbi and cmi) located adjacent to the toxin genes . These genetic elements are commonly associated with recombinases (e.g., xerD) and transposases, suggesting active mobility and horizontal gene transfer .
The cbi gene is typically co-located with genes involved in conjugal plasmid transfer (e.g., tra genes) or plasmid maintenance (e.g., spo0J for chromosome partitioning and parM for plasmid segregation) . This genomic context reinforces the plasmid-borne nature of these immunity systems. In some E. coli isolates, the contigs encoding colicin B and its immunity protein also carry antibiotic resistance genes, such as those conferring resistance to aminoglycosides (aph(6)-Id) and tetracycline (tet(C)) . This genetic linkage suggests potential co-selection of colicin immunity and antibiotic resistance traits in bacterial populations.
For successful expression of recombinant Cbi, strong overexpression systems are typically required . Since Cbi is a membrane protein with hydrophobic domains, expression systems that can handle membrane proteins are preferred. When designing expression constructs, researchers should consider the following:
Use of E. coli strains optimized for membrane protein expression
Inducible promoters with tunable expression levels
Fusion tags that assist in purification while minimizing interference with membrane insertion
Growth at lower temperatures (16-25°C) to reduce inclusion body formation
Supplementation with appropriate chaperones to assist proper folding
The identity of recombinant Cbi can be confirmed through electrophoretic analysis, with the expected molecular weight of approximately 20,000 Da .
To study the interactions between Cbi and colicin B, researchers have employed several approaches:
Hybrid protein construction: Creating Cbi/Cai hybrids to determine which regions confer specificity for particular colicins
Domain exchange experiments: Exchanging hydrophilic loops between Cai and Cbi to study structure-function relationships
Fragmentation studies: Producing Cbi as separate fragments to identify functional domains
Membrane localization assays: Fractionation techniques to confirm the presence of Cbi in membrane compartments
Site-directed mutagenesis: Modifying specific residues to determine their contribution to immunity function
These methodologies have revealed unexpectedly high structural constraints for Cbi function, indicating complex interaction mechanisms between immunity proteins and their cognate colicins .
Research has revealed surprising insights into the functional domains of Cbi. Contrary to initial expectations, the periplasmic loops of Cbi do not carry the determinants for colicin recognition, despite most of these loops being required for proper Cbi function . The cytoplasmic loop of Cbi has been found to be involved in both the topology and function of the protein . Importantly, studies have shown that the immunity function is not confined to a particular region of the immunity protein but rather requires the coordinated action of multiple structural elements . This distributed functionality presents challenges for designing minimal functional constructs and suggests that the three-dimensional arrangement of Cbi domains is critical for its protective capacity.
Understanding the precise membrane topology of Cbi is crucial for elucidating its immunity mechanism. The four large hydrophobic regions of Cbi suggest a complex membrane insertion pattern . Research indicates that Cbi interacts with colicin B within the core of the lipid bilayer, specifically targeting the hydrophobic transmembrane helices of the colicin . This interaction likely prevents the colicin from adopting its pore-forming conformation. The integral membrane nature of Cbi positions it strategically to intercept colicin B at the site of potential damage, representing an efficient defense strategy. Future research employing techniques such as cysteine-scanning mutagenesis combined with accessibility studies could further illuminate the precise topology and interaction interfaces.
Comparative analyses reveal that colicin immunity systems have diversified across bacterial species while maintaining similar functional principles. The E. coli Cbi shows significant homology to the colicin A immunity protein (Cai), suggesting common ancestry . Beyond E. coli, ColM-like bacteriocins have been identified in β-proteobacterial strains including Burkholderia species, with corresponding immunity proteins that differ substantially from known ColM immunity genes . These divergent immunity proteins encode inner membrane-associated proteins of distinct types, which differ in predicted transmembrane topology and moiety exposed to the periplasm . This diversification illustrates the evolutionary plasticity of bacteriocin-immunity pairs while maintaining their protective function, potentially reflecting adaptation to different ecological niches and competitive pressures.
The co-evolution of colicin B and its immunity protein reflects selective pressures in bacterial communities. The frequent association of colicin genes with mobile genetic elements suggests horizontal gene transfer plays a significant role in their dissemination . The co-occurrence of colicin B with colicin M genes suggests potential functional synergy between these bacteriocins . Additionally, the linkage with antibiotic resistance genes on the same genetic elements suggests selection in environments where both bacteriocin production and antibiotic resistance confer advantages . The structural conservation of critical motifs like the α1–α2 motif in immunity proteins, despite sequence divergence, indicates strong functional constraints during evolution . Understanding these evolutionary dynamics provides insights into bacterial competition and could inform strategies for manipulating bacterial communities.
Recombinant Cbi presents valuable applications as a research tool in molecular microbiology:
Membrane protein interaction studies: As a model system for investigating integral membrane protein interactions
Specificity determinants investigation: For studying the molecular basis of high-affinity protein-protein recognition
Bacterial competition models: As a component in systems modeling bacterial warfare and population dynamics
Selection marker: As a potential selection system in synthetic biology applications
Structural biology platform: For understanding membrane protein insertion and topology
The ultra-high affinity interactions between colicins and immunity proteins make them excellent subjects for studying the principles governing specific protein-protein interactions in biological systems .
Several methodological challenges complicate research on Cbi-colicin interactions:
Membrane protein expression: Overcoming hydrophobicity and toxicity through specialized expression systems and detergent optimization
Structural analysis: Using advanced techniques such as cryo-electron microscopy or NMR methods optimized for membrane proteins
In vitro reconstitution: Developing liposome or nanodisk systems that recapitulate the native membrane environment
Quantifying interactions: Employing surface plasmon resonance or microscale thermophoresis adapted for membrane proteins
Visualizing in vivo dynamics: Utilizing advanced fluorescence microscopy with minimal fluorescent tags
Addressing these challenges requires interdisciplinary approaches combining molecular biology, biophysics, structural biology, and computational modeling to fully elucidate the complex dynamics of these immunity systems.