Recombinant Shigella sonnei Colicin-E1 (cea)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
cea; Colicin-E1*
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-521
Protein Length
full length protein
Species
Shigella sonnei
Target Names
cea
Target Protein Sequence
METAVAYYKDGVPYDDKGEVIITLLNGNPDGSGSGGGGGTGGSKSESSAAIHATAKWSTA QLKKTQAEQAARAKAAAEAQAKAKANRDALTQHLKDIVNEALRHNSTHPEVIDLLMPIMQ RCRQKQSGCALQKQKKKPVKKRKRAEKSFQEAEQRRKEIEKEQAETERQLKLAEDEEKRL AALSEEARAVEVAQKNLAAAQSELAKVDEEINTLNTRLSSSIHARDAETNTLSGKRNELD QASAKYKELDERVKLLSPRANDPLQSRPFFEATRLRARRGDEMEEKQKQVTATETRLNQI SSEINGIQEAISQANNKRSTAVSRIHDAEDNLKTAQTNLLNSQIKDAVDATVSFYQTLSE KYGEKYSKMAQELADKSKGKKISNVNEALAAFEKYKDVLNKKFSKADRDAIFNALEAVKY EDWAKHLDQFAKYLKITGHVSFGYDVVSDILKIKDTGDWKPLFLTLEKKAVDAGVSYVVV LLFSVLAGTTLGIWGIAIVTGILCAFIDKNKLNTINEVLGI
Uniprot No.

Target Background

Function

This colicin is a channel-forming toxin. These transmembrane toxins depolarize the cytoplasmic membrane, resulting in energy dissipation. Colicins are polypeptide toxins produced by and active against E. coli and closely related bacteria.

Protein Families
Channel forming colicin family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Colicin-E1 and how does it differ from other colicins produced by Shigella sonnei?

Colicin-E1 is a bacteriocin produced by Shigella sonnei that functions as a pore-forming toxin, creating channels in the bacterial membrane of target cells, which leads to membrane depolarization and ultimately cell death . Unlike most other E-class colicins that function as nucleases targeting DNA or RNA, Colicin-E1 is distinctive in its membrane pore-forming activity . The genetic structure of colicins typically consists of three essential components: the colicin structural gene (cea in the case of ColE1), an immunity gene (imm) that protects the producing cell from self-intoxication, and a lysis protein gene (kil) that facilitates release of the colicin .

What cellular mechanisms are involved in Colicin-E1 uptake and activity?

Colicin-E1 uptake begins with binding to the BtuB receptor (vitamin B12 transporter) on the outer membrane of susceptible bacteria . Unlike other colicins that may use different translocation systems, the drug-export protein TolC is essential for the import of Colicin-E1 across the outer membrane and periplasmic space . Once internalized, Colicin-E1 inserts into the cytoplasmic membrane to form voltage-gated ion channels that disrupt the membrane potential, leading to macromolecular synthesis inhibition without arresting respiration . This mechanism differs from other colicins such as E2, which causes DNA breakdown, or E3, which inhibits protein synthesis .

How does Shigella sonnei regulate the production of Colicin-E1?

Colicin production in S. sonnei is tightly regulated and typically induced by environmental stressors. DNA-damaging agents (UV radiation, mitomycin C) or environmental factors such as increasing population density and nutrient depletion trigger colicin expression . At the molecular level, this regulation operates through the bacterial SOS system of DNA repair. When DNA damage occurs, the RecA proteinase is activated, which facilitates the autocleavage of the LexA repressor protein . Since LexA normally suppresses both DNA repair genes and plasmid genes for colicin synthesis, its inactivation results in de-repression of colicin production . Under standard conditions, only a small subpopulation of bacteria express colicins, as production is typically lethal for the producing cell .

What are the optimal conditions for expressing and purifying recombinant Colicin-E1 from Shigella sonnei?

For optimal expression and purification of recombinant Colicin-E1 from S. sonnei, researchers should consider the following protocol:

Expression System:

  • Use E. coli-based expression systems with vectors containing strong inducible promoters

  • Include the full 1-521 amino acid sequence for complete functional activity

Expression Conditions:

  • Induce expression at OD600 of 0.6-0.8

  • For SOS-dependent expression, mitomycin C (0.5-1 μg/ml) can be used as an inducer

  • Maintain culture at 30°C post-induction to balance protein yield with proper folding

Purification Strategy:

  • Harvest cells by centrifugation (6,000×g, 15 min, 4°C)

  • Lyse cells using sonication or pressure-based methods in Tris buffer (50 mM, pH 8.0)

  • Clarify lysate by centrifugation (15,000×g, 30 min, 4°C)

  • Employ affinity chromatography (His-tag systems work well)

  • Further purify using ion-exchange chromatography

  • Concentrate protein in storage buffer (Tris-based buffer with 50% glycerol)

Storage:

  • Store at -20°C for routine use or -80°C for extended storage

  • Avoid repeated freeze-thaw cycles

  • Working aliquots can be maintained at 4°C for up to one week

The purity should be assessed using SDS-PAGE (target >85%) , and activity should be confirmed through bactericidal assays against sensitive E. coli strains.

How can researchers reliably detect and characterize colicin production in Shigella sonnei isolates?

Detection and characterization of colicin production in S. sonnei isolates can be conducted through a multi-step approach:

1. Initial Screening for Colicin Production:

  • Overlay method: Spot potential producer strains on nutrient agar and incubate (37°C, 18h), then overlay with soft agar containing indicator strain (E. coli DH5α)

  • Observe for zones of growth inhibition around producer colonies (positive for colicin production)

2. PCR-Based Detection of Colicin Types:

  • Extract plasmid DNA using standard alkaline lysis methods

  • Perform PCR with colicin-specific primers for E-class colicins (E1-E9)

  • For Colicin-E1 (cea), use specific primers targeting the conserved regions of the cea gene

3. Quantitative Bactericidal Assay:

  • Prepare cell-free supernatants from cultures grown to stationary phase

  • Serially dilute supernatants and incubate with standardized cultures of indicator strains

  • Quantify killing by viable count determination

  • Calculate arbitrary units based on the highest dilution showing killing activity

4. Molecular Characterization:

  • Sequence analysis of colicin-encoding genes

  • Plasmid profiling to identify colicinogenic plasmids

  • Southern blot analysis using cea gene probe

In a screening study of 42 S. sonnei strains from diarrheal patients, 93% were positive for colicin production against E. coli DH5α. Among these colicin-producing strains, PCR typing identified 92.3% as producing E3, 5.1% as producing both E3 and E8, and 2.6% as producing both E3 and E2 . This approach allows comprehensive characterization of colicin production profiles in clinical isolates.

What mechanisms contribute to colicin resistance in target bacteria, and how can these be experimentally characterized?

Bacteria develop resistance to colicins through several distinct mechanisms, which can be experimentally characterized using the following approaches:

Common Resistance Mechanisms:

MechanismMolecular BasisExperimental Detection
Receptor MutationAlterations in BtuB receptorPCR amplification and sequencing of btuB gene
Insertion Sequence DisruptionIS elements (IS1, IS2, IS911) interrupting btuBLong-range PCR and sequence analysis
Translocation System DefectsMutations in TolC or other import proteinsComplementation studies with wild-type genes
Immunity Protein AcquisitionHorizontal gene transfer of immunity genesPCR detection of immunity genes

Research has shown that colicin-resistant E. coli mutants occur spontaneously at rates of 2.51×10⁻⁸ and 5.52×10⁻⁸ per generation when exposed to colicins E3/E8 and E3/E2, respectively . Genotypic characterization revealed that resistant strains frequently display mutations in the btuB gene, which encodes the receptor for vitamin B12 uptake .

Experimental Characterization Protocol:

  • Fluctuation Testing for Resistance Rate:

    • Grow multiple parallel cultures of sensitive bacteria

    • Plate on media containing purified colicin

    • Calculate mutation rate using appropriate statistical methods (e.g., Luria-Delbrück method)

  • Genetic Basis of Resistance:

    • Isolate and sequence the btuB gene from resistant mutants

    • Perform whole-genome sequencing to identify additional mutations

    • Conduct complementation studies by introducing wild-type btuB on plasmids (pbtuB)

  • Functional Validation:

    • Assess vitamin B12 uptake in resistant mutants compared to wild-type strains

    • Measure membrane binding of fluorescently labeled colicins

    • Perform competition assays between resistant and sensitive strains

Studies have confirmed that complementation of colicin-resistant E. coli and S. sonnei strains with plasmid-borne btuB successfully restores the colicin-susceptible phenotype, validating the critical role of this receptor in colicin activity .

How does the competitive advantage conferred by Colicin-E1 compare with that of the Type VI Secretion System (T6SS) in Shigella sonnei?

Recent research has challenged previous assumptions about S. sonnei's primary competition mechanisms, revealing important distinctions between Colicin-E1 and T6SS systems:

Competitive Mechanism Comparison:

FeatureColicin-E1 SystemType VI Secretion System (T6SS)
Genetic LocationPlasmid-encoded (spB plasmid)Chromosomally encoded
RegulationSOS response, nutrient limitationComplex environmental signals
Target RangeBroad (multiple E. coli pathotypes)Narrower (specific competitors)
Killing MechanismPore formation in target membraneInjection of toxic effectors
Metabolic CostHigh (often lethal to producer)Lower (reusable apparatus)
Evolutionary Status in S. sonneiMaintained functional systemEvidence of functional degradation

Recent experimental studies with S. sonnei strain SS381 and isolate CIP106347 demonstrated that the anti-bacterial activity previously attributed to T6SS was actually due to colicin activity . Detailed genomic analysis revealed that the T6SS operon in S. sonnei contains multiple mutations including SNPs, indels, and insertion sequences in key components, indicating functional degradation of this system .

When researchers created synthetically inducible T6SS operons, they were still unable to demonstrate anti-bacterial activity. In contrast, S. sonnei strains showed strong anti-bacterial activity against E. coli through colicin mechanisms. This activity was eliminated when either the target bacteria were made colicin-resistant or the colicin plasmid was removed from S. sonnei .

These findings suggest that while both systems theoretically provide competitive advantages in polymicrobial environments, S. sonnei has evolved to rely primarily on colicin-mediated competition rather than T6SS, possibly due to the sufficient effectiveness of colicins in the gastrointestinal niche .

What evolutionary processes have shaped the diversity of colicins in Shigella and related Enterobacteriaceae?

The evolution of colicin diversity in Shigella and related Enterobacteriaceae has been driven by several evolutionary mechanisms that can be experimentally investigated:

Key Evolutionary Processes:

  • Sequential Change in Immunity:

    • Initial mutation in immunity gene providing resistance

    • Secondary mutation in colicin gene creating "super killer" phenotype

    • Positive selection driving diversification through immunity function

    • Accumulation of synonymous and nonsynonymous substitutions in immunity region

  • Domain Recombination:

    • Recombination between functional domains of different colicins

    • Creation of mosaic proteins with new specificities

    • Explains why sequence similarity within pore-forming colicins rarely exceeds 40%

  • Horizontal Gene Transfer:

    • Plasmid transfer between bacterial species

    • Acquisition of new colicin genes or operons

    • Integration into existing regulatory networks

  • Selective Pressure from Microbial Competition:

    • Gastrointestinal environment contains 10¹¹-10¹³ commensal bacteria per gram

    • Enteric pathogens must compete with resident microbiota to establish infection

    • Different Shigella species employ varying competition strategies

Experimental support for these evolutionary mechanisms comes from comparative genomics studies showing that colicin diversity contributes to the enormous variation in E. coli DNA (approximately 5%), which is among the highest diversity expected in a single bacterial species . Additionally, the distribution of colicin types varies between Shigella species, with S. sonnei predominantly carrying E-class colicins (particularly E3) , while other species may employ different competitive mechanisms.

The model of 'super killer' emergence through sequential immunity and colicin gene mutations provides a particularly compelling explanation for the diversification of colicin proteins and their immunity partners under strong positive selection pressure in densely populated microbial communities .

How can recombinant Colicin-E1 be utilized for studying bacterial competition in complex microbiome environments?

Recombinant Colicin-E1 offers several experimental approaches for investigating bacterial competition dynamics in complex microbiome environments:

Methodological Applications:

  • In vitro Competition Models:

    • Fluorescently labeled bacterial populations co-cultured in continuous bioreactors

    • Addition of purified recombinant Colicin-E1 at defined concentrations

    • Flow cytometry monitoring of population shifts over time

    • Quantification of ecological succession patterns

  • Ex vivo Gut Microbiome Studies:

    • Human or animal gut content samples maintained in anaerobic conditions

    • Introduction of Colicin-E1 producing S. sonnei (or purified protein)

    • 16S rRNA sequencing to monitor community composition changes

    • Metabolomic analysis to detect functional alterations

  • In vivo Models with Defined Communities:

    • Gnotobiotic animal models with defined bacterial consortia

    • Controlled introduction of wild-type and colicin-deficient S. sonnei

    • Spatiotemporal mapping of bacterial populations using imaging techniques

    • Recovery and enumeration of bacterial populations from different gut regions

Research has demonstrated that S. sonnei strains producing colicins exhibit antagonism against various diarrheagenic Escherichia coli (DEC) groups, suggesting important ecological implications for enteric pathogen competition . Given that enteric pathogens must compete with 10¹¹-10¹³ commensal bacteria per gram of colonic contents , these competition mechanisms are critical for understanding pathogen establishment in the gastrointestinal tract.

Future research could employ recombinant Colicin-E1 to investigate how population-level killing by colicins affects microbiome resilience, pathogen clearance, and ecological succession patterns following perturbations such as antibiotic treatment or inflammation.

What are the challenges and potential solutions in using plasmid-based systems for stable expression of recombinant Colicin-E1?

Expression of recombinant Colicin-E1 using plasmid-based systems presents several challenges due to the nature of the protein and the characteristics of expression vectors. Understanding these challenges and implementing appropriate solutions is critical for successful experimental applications:

Challenges and Solutions Table:

ChallengeUnderlying MechanismPotential Solutions
Plasmid InstabilityRandom segregation during cell divisionInclude stability elements like toxin-antitoxin systems (pemI/pemK)
Self-ToxicityColicin activity against producer cellsCo-express immunity protein (cei) with colicin
Copy Number FluctuationVariability in plasmid replicationUse origin modifications that stabilize copy number
Reduced Growth of HostMetabolic burden of recombinant expressionOptimize induction conditions and expression levels
Inconsistent ExpressionRepression of colicin promotersUse heterologous promoters instead of native SOS-regulated promoters

Interestingly, research has demonstrated that increased plasmid copy number does not necessarily correlate with increased plasmid stability, contradicting the classic random distribution model . For stable expression of potentially toxic proteins like Colicin-E1, the addition of toxin-antitoxin addiction systems such as pemI/pemK can dramatically improve plasmid retention, with >80-90% of cells retaining plasmid after multiple passages without antibiotic selection .

When designing expression systems specifically for Colicin-E1, researchers should consider including both the cea gene and its cognate immunity gene (cei) to prevent self-intoxication, while also incorporating appropriate stability elements derived from natural colicinogenic plasmids.

What insights can comparative genomic analysis of colicin-encoding plasmids in Shigella sonnei provide for understanding pathogen evolution?

Comparative genomic analysis of colicin-encoding plasmids in Shigella sonnei offers valuable insights into pathogen evolution, adaptation, and competition strategies:

Research Approaches and Findings:

  • Plasmid Structure Analysis:

    • The spB plasmid backbone in S. sonnei consists of mobilization genes (mobA, exc1, exc2) and genes essential for colicin expression (cea, cei, cel)

    • E-class colicins are typically encoded on small high-copy number plasmids

    • Plasmid architecture suggests optimization for horizontal transfer and maintenance

  • Geographic and Temporal Distribution:

    • Analysis of S. sonnei isolates from different geographic regions shows variation in colicin types

    • Among 42 strains from diarrheal patients, 93% were positive for colicin production

    • Distribution pattern: 92.3% carried E3, 5.1% carried E3+E8, and 2.6% carried E3+E2

    • These patterns may reflect different selective pressures in various environments

  • Co-evolution with Virulence Factors:

    • Some S. sonnei strains simultaneously carry colicinogenic plasmids and Shiga toxin genes

    • In 2014-2015, Stx1-producing S. sonnei infections were detected in California

    • This suggests potential interaction between competition mechanisms and virulence determinants

  • Functional Redundancy and Specialization:

    • S. sonnei possesses both T6SS operons and colicin plasmids, but shows evidence of T6SS degradation

    • This suggests that colicin-mediated competition may have become the preferred mechanism

    • Potential functional redundancy may have allowed genetic drift in alternative systems

The shifting epidemiology of Shigella species globally, with S. sonnei becoming increasingly prevalent in developing countries (causing over 90% of shigellosis cases along with S. flexneri) , may be partially explained by its effective competition strategies. The widespread presence of colicin-encoding plasmids in clinical isolates suggests these elements confer significant fitness advantages in both environmental and host niches.

Future research should explore the co-evolution of chromosomal and plasmid-encoded functions in S. sonnei, potentially revealing how pathogens balance the metabolic costs of maintaining multiple competition systems against the benefits of effective niche competition in complex microbial communities.

What emerging technologies might enhance research on the ecological role of Colicin-E1 in microbial communities?

Several cutting-edge technologies are poised to transform our understanding of Colicin-E1's ecological functions:

  • Single-cell RNA sequencing for measuring differential gene expression in target populations after colicin exposure

  • CRISPR-Cas9 screening to identify previously unknown factors affecting colicin sensitivity or resistance

  • Microfluidic co-culture systems enabling direct observation of competitive interactions at single-cell resolution

  • In situ metagenomic sequencing for tracking changes in colicin gene prevalence within natural communities

  • Protein engineering approaches to create modified colicins with altered receptor specificities for targeted studies

These technologies will help address fundamental questions about the contribution of colicins to S. sonnei's competitive success in diverse environments, potentially leading to novel antimicrobial strategies targeting multi-drug resistant pathogens.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.