Recombinant Colicin-Ia immunity protein

Shipped with Ice Packs
In Stock

Description

Introduction to Colicin Ia and Its Immunity Protein

Colicin Ia is a pore-forming bacteriocin produced by Escherichia coli strains carrying specific plasmids. Its activity is neutralized by the Colicin-Ia immunity protein (ImmIa or Iia), a 111-amino acid polypeptide co-encoded with the colicin gene to protect producer cells from autotoxicity . This protein localizes to the inner membrane, physically blocking pore formation by Colicin Ia . Recombinant production of ImmIa enables its study and application in biotechnology, particularly in antimicrobial research and plasmid engineering.

Domain Architecture

ImmIa lacks distinct catalytic domains, functioning instead through steric hindrance. Its structure includes hydrophobic regions that interact with the pore-forming domain of Colicin Ia, preventing membrane insertion .

Interaction Mechanism

ImmIa binds to Colicin Ia’s cytotoxic domain (C-terminal region), forming a stable complex that inhibits pore formation. This interaction is essential for producer cell survival, as Colicin Ia otherwise disrupts membrane integrity via voltage-gated channel formation .

Key Production Challenges

  • Toxicity Risks: While ImmIa itself is non-toxic, co-expression with Colicin Ia requires stringent plasmid regulation to prevent unintended pore formation .

  • Purification: The His-tag facilitates nickel or cobalt affinity chromatography for high-purity isolation .

Antimicrobial Studies

ImmIa is used to study colicin resistance mechanisms and plasmid dynamics. For example, plasmids encoding Colicin Ia and microcin V often coexist, suggesting evolutionary advantages in niche competition .

Biotechnological Tools

  • Plasmid Engineering: ImmIa-containing plasmids enable stable maintenance of Colicin Ia genes without autotoxicity .

  • Protein Export Systems: ImmIa’s interaction with Colicin Ia aids in studying bacterial secretion pathways and membrane protein folding .

Co-Occurrence with Colicin Ia

ImmIa is tightly linked to Colicin Ia genes on high-molecular-weight plasmids (80–150 kbp). Studies show non-random distribution of these plasmids across E. coli genetic groups, particularly in human-associated strains .

Strain GroupColicin Ia FrequencyMicrocin V Co-OccurrenceSignificance (P-value)
Human (B2)3.7%7.1%<0.001
Animal (B2)17.8%2.3%<0.001

Functional Specificity

ImmIa exhibits high specificity for Colicin Ia, with no cross-reactivity reported for other pore-forming colicins (e.g., E1, Ib) . This specificity is critical for plasmid stability in mixed populations.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, should you have specific format requirements, please indicate them during order placement. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a reference for customers.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development accordingly.
Synonyms
Colicin-Ia immunity protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-111
Protein Length
full length protein
Species
Escherichia coli
Target Protein Sequence
MNRKYYFNNMWWGWVTGGYMLYMSWDYEFKYRLLFWCISLCGMVLYPVAKWYIEDTALKF TRPDFWNSGFFADTPGKMGLLAVYTGTVFILSLPLSMIYILSVIIKRLSVR
Uniprot No.

Target Background

Function
This protein effectively protects cells harboring the plasmid ColIa-CA53 encoding colicin Ia against colicin Ia.
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Colicin-Ia immunity protein and how does it function?

Colicin-Ia immunity protein (Iia) is a specific protein that protects colicinogenic cells from the cytotoxic activity of colicin Ia. The immunity protein functions through direct interaction with its cognate colicin. When a bacterium produces colicin Ia, it simultaneously produces the immunity protein to protect itself from its own toxin. The immunity to colicin Ia is defined as complete insensitivity of a strain to colicin Ia while maintaining sensitivity to other colicins such as colicin Ib-P9 . Studies have demonstrated that the immunity protein is equally effective at all colicin concentrations tested, suggesting a highly efficient protective mechanism .

How is the Colicin-Ia immunity protein genetically encoded?

The Colicin-Ia immunity protein is encoded by the iia gene, which is tightly linked to the colicin Ia structural gene (cia) on high molecular weight plasmids . This genetic linkage ensures co-expression of the toxin and immunity components, providing protection to the producing cell. The gene arrangement reflects an evolutionary strategy to prevent self-killing. The cia and iia genes from plasmid pColIa-CA53 have been successfully cloned into vectors such as pBR322, demonstrating that these genes can be manipulated for recombinant expression . The tight linkage between toxin and immunity genes is a common feature among bacteriocins, serving as a protective mechanism for the producer strain .

What expression systems are most effective for recombinant Colicin-Ia immunity protein production?

For recombinant expression of Colicin-Ia immunity protein, E. coli-based expression systems have proven most effective due to the protein's bacterial origin. The pBR322 vector system has been successfully used to clone and express the iia gene, resulting in functional immunity protein production . When designing expression constructs, it's important to consider that the iia gene can be expressed independently of the colicin structural gene while maintaining full functionality.

Researchers have demonstrated that strains carrying plasmids with the cloned iia+ gene were equally immune to colicin Ia at all concentrations tested compared to strains with the native pColIa-CA53 plasmid . This indicates that recombinant expression systems can achieve biologically relevant levels of immunity protein production. For optimal results, inducible promoter systems like the tac promoter can be employed to control expression timing and level .

How can I verify the functionality of recombinant Colicin-Ia immunity protein?

Verification of recombinant Colicin-Ia immunity protein functionality involves several complementary approaches:

  • Immunity testing: The most direct method is to express the recombinant immunity protein in a colicin-sensitive strain and challenge it with purified colicin Ia. Functional immunity protein will confer complete insensitivity to colicin Ia while maintaining sensitivity to other colicins (e.g., colicin Ib-P9) .

  • Co-immunoprecipitation assays: Following the approach used for colicin A immunity protein studies, you can create epitope-tagged versions of the immunity protein to demonstrate specific interaction with colicin Ia. This technique has been successfully applied to show that immunity proteins interact with their cognate colicins .

  • Growth inhibition assays: Compare growth curves of strains with and without the recombinant immunity protein in the presence of colicin Ia. Strains expressing functional immunity protein will show normal growth patterns despite colicin exposure.

It's important to include appropriate controls, such as testing immunity against unrelated colicins, to confirm specificity of the immunity protein function.

What purification strategies work best for recombinant Colicin-Ia immunity protein?

Purification of recombinant Colicin-Ia immunity protein can be achieved through a combination of techniques:

  • Affinity chromatography: Fusion tags such as His6, GST, or epitope tags can be added to the recombinant immunity protein to facilitate purification. For instance, researchers have successfully used epitope-tagged immunity proteins (like EpCai for colicin A) that can be detected and purified while maintaining function .

  • Ion exchange chromatography: Based on the predicted isoelectric point of the immunity protein, appropriate ion exchange resins can be selected for purification steps.

  • Size exclusion chromatography: As a final polishing step, this method can separate the immunity protein from contaminants of different molecular sizes.

When designing purification protocols, it's crucial to consider that immunity proteins often form stable complexes with their cognate colicins. If co-expressed, additional steps may be needed to dissociate these complexes without denaturing the immunity protein.

How does the Colicin-Ia immunity protein interact with its cognate toxin at the molecular level?

The molecular interaction between Colicin-Ia immunity protein and its cognate toxin involves specific recognition of structural elements. While the specific details for Colicin-Ia immunity protein are not fully elucidated in the provided search results, insights can be drawn from related systems. For instance, in the case of colicin A, the immunity protein (Cai) specifically interacts with the hydrophobic helical hairpin region of the pore-forming domain .

Based on sequence homology studies that have separated pore-forming colicins into two groups (type A and type E1), colicin Ia belongs to the type E1 group along with colicins E1, 5, K, 10, and Ib . This suggests that the immunity protein-toxin interaction mechanism may share similarities with other members of this group.

The interaction is highly specific, as immunity proteins typically only protect against their cognate colicins. This specificity likely arises from recognition of unique structural features in the C-terminal pore-forming domain of the colicin, preventing the conformational changes necessary for pore formation in the inner membrane.

What is known about the coassociation of Colicin Ia with other bacteriocins and implications for immunity?

Research has revealed a significant coassociation between colicin Ia and microcin V in bacterial strains. This coassociation occurs more frequently than would be expected by chance, indicating potential evolutionary or functional advantages . Key findings include:

E. coli GroupColicin Ia PositiveMicrocin V PositiveCoassociation Rate
ACommonCommonHigh
B1PresentPresentLow (not observed)
B2CommonCommonHigh
DPresentPresentIntermediate

When colicin Ia and microcin V co-occur in a strain, they are invariably encoded on the same conjugative plasmid. In a study of 36 transconjugants obtained from strains positive for one or both bacteriocins, all 23 transconjugants from donor strains positive for both bacteriocins harbored a single plasmid encoding both toxins .

This coassociation raises important questions for immunity research, as strains producing both bacteriocins must express immunity factors for both to avoid self-killing. Understanding the genetic organization and potential interactions between these immunity systems could provide insights into the evolution of bacteriocin immunity mechanisms and possible cross-protection effects.

How can recombinant Colicin-Ia immunity protein be engineered for enhanced stability or function?

Engineering recombinant Colicin-Ia immunity protein for enhanced properties requires strategic modifications based on structure-function relationships:

  • Stability enhancements: Based on studies of similar immunity proteins, introducing disulfide bonds at strategic positions can increase thermal stability without compromising function. Additionally, identifying and mutating proteolytically sensitive sites can extend protein half-life.

  • Affinity optimization: Directed evolution approaches can be employed to select for immunity protein variants with higher affinity for colicin Ia. This could involve creating libraries of immunity protein mutants and screening for enhanced protective capacity.

  • Broadened specificity: While immunity proteins typically have narrow specificity, engineering chimeric immunity proteins that combine recognition elements from different immunity proteins could potentially create variants that protect against multiple colicins.

When designing these engineering strategies, it's essential to preserve the specific interaction sites with colicin Ia. The identification of specific domains involved in immunity, such as the internal 2,400-bp ClaI fragment that has been shown to carry all the information necessary to determine colicin immunity , provides valuable targets for rational protein engineering.

What experimental approaches are most effective for studying Colicin-Ia immunity protein interactions in membrane environments?

Studying Colicin-Ia immunity protein interactions in membrane environments requires specialized techniques that can capture these dynamics:

  • Membrane protein fusion constructs: Creating fusion proteins between immunity protein domains and reporter proteins like alkaline phosphatase has proven effective for studying colicin immunity proteins. For example, researchers have successfully used fusion proteins comprising hydrophobic α-helices of colicin A fused to alkaline phosphatase to demonstrate specific interactions with immunity proteins .

  • Reconstituted membrane systems: Liposomes or nanodiscs containing purified recombinant immunity proteins can be used to study protection mechanisms against colicin-mediated pore formation. These systems allow controlled manipulation of membrane composition and protein concentrations.

  • In vivo cross-linking: Chemical cross-linking followed by mass spectrometry can identify specific contact points between immunity proteins and colicins in native membrane environments.

  • Electrophysiological measurements: Planar lipid bilayer experiments can directly measure the ability of immunity proteins to prevent colicin-induced channel formation, providing functional data to complement structural studies.

These approaches collectively provide a comprehensive understanding of how immunity proteins function within the membrane context to neutralize the toxic effects of their cognate colicins.

What are the major challenges in structural studies of Colicin-Ia immunity protein?

Structural studies of Colicin-Ia immunity protein face several significant challenges:

  • Membrane association: The immunity protein likely interacts with membrane-embedded regions of colicin Ia, making traditional structural biology techniques challenging to apply. This is reflected in studies of related systems where immunity proteins interact with hydrophobic helical regions of colicins .

  • Complex formation dynamics: Capturing the transient states of immunity protein-colicin interactions, particularly during the protection process, is technically demanding and may require specialized approaches like time-resolved structural methods.

  • Expression and purification: Maintaining the native conformation of immunity proteins during recombinant expression and purification is crucial for structural studies but can be difficult due to potential misfolding or aggregation when removed from their natural membrane environment.

The approach used for colicin A immunity protein studies, where fusion proteins comprising specific helical regions were created to demonstrate interactions , offers a potential strategy to overcome some of these challenges for Colicin-Ia immunity protein research.

How does gene regulation affect recombinant expression of Colicin-Ia immunity protein?

Gene regulation is a critical factor in recombinant expression of Colicin-Ia immunity protein. In natural systems, the expression of colicin Ia and its immunity protein is regulated by the SOS system during stress conditions . For optimal recombinant expression, several regulatory considerations must be addressed:

  • Promoter selection: While the native regulation involves the SOS system, recombinant expression often employs inducible promoters like the tac promoter, which has been successfully used for expression of colicin-related constructs .

  • Expression balancing: When co-expressing colicin Ia and its immunity protein, the immunity protein must be expressed at sufficient levels to neutralize the potentially toxic effects of the colicin. Experimental evidence shows that in natural systems, immunity is complete even at high colicin concentrations .

  • Host strain considerations: The genomic background of the host strain can influence plasmid maintenance and expression levels, as evidenced by the nonrandom distribution of colicin Ia plasmids with respect to E. coli host strain backgrounds .

Optimizing these regulatory elements is essential for successful recombinant production of functional Colicin-Ia immunity protein, particularly when the recombinant protein is intended for structural or functional studies.

What potential biotechnological applications exist for recombinant Colicin-Ia immunity protein?

Recombinant Colicin-Ia immunity protein offers several promising biotechnological applications:

  • Selective bacterial growth control: The specific immunity conferred by the protein could be exploited in mixed bacterial cultures to selectively protect desired strains while allowing colicin Ia to eliminate competing strains.

  • Biosensors for colicin detection: Immunity proteins could be incorporated into biosensor platforms to specifically detect the presence of colicin Ia in environmental or clinical samples.

  • Protein engineering platforms: The highly specific interaction between immunity proteins and colicins provides a model system for studying protein-protein interactions and designing novel binding proteins with tailored specificities.

  • Protective adjuncts for probiotic bacteria: Engineered probiotics expressing recombinant immunity proteins could be protected from specific colicins produced by competing bacteria in the gut microbiome.

Research on the coassociation of colicin Ia with microcin V on the same plasmid suggests that there may be evolutionary advantages to combining different bacteriocin systems. This natural strategy could inspire biotechnological applications that leverage multiple bacteriocin-immunity pairs for enhanced specificity or broader protection spectrum.

What are the most significant unanswered questions about Colicin-Ia immunity protein?

Despite considerable progress in understanding Colicin-Ia immunity protein, several important questions remain unanswered:

  • Structural basis of immunity: While functional studies have identified the immunity-determining region , the three-dimensional structure of the Colicin-Ia immunity protein, particularly in complex with colicin Ia, has not been fully elucidated.

  • Evolutionary origins: The mechanisms driving the observed coassociation between colicin Ia and microcin V, and how their respective immunity systems might interact, remain to be fully explained .

  • Membrane topology: The precise arrangement of the immunity protein in relation to the membrane and its conformational changes upon colicin binding require further investigation.

  • Cross-immunity potential: Whether engineered variants of the immunity protein could provide protection against other related colicins without compromising specificity is an open question with significant implications for biotechnology.

These knowledge gaps represent opportunities for researchers to make substantial contributions to our understanding of bacteriocin immunity systems and their applications.

What emerging technologies might advance Colicin-Ia immunity protein research?

Several emerging technologies hold promise for advancing Colicin-Ia immunity protein research:

  • Cryo-electron microscopy: Recent advances in cryo-EM have enabled structural determination of membrane proteins and complexes at near-atomic resolution, potentially allowing visualization of immunity protein-colicin interactions in membrane environments.

  • Single-molecule approaches: Techniques such as single-molecule FRET or force spectroscopy could provide insights into the dynamics of immunity protein binding to colicin Ia and the resulting conformational changes.

  • Computational modeling and simulation: Molecular dynamics simulations of immunity proteins in membrane environments could predict structural features and interaction mechanisms that are difficult to study experimentally.

  • CRISPR-based genome editing: Precise modification of immunity protein genes in their native context could reveal functional requirements and potential for engineering enhanced variants.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.