Recombinant Colicin-Ib immunity protein

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
Colicin-Ib immunity protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-115
Protein Length
full length protein
Species
Escherichia coli
Target Protein Sequence
MKLDISVKYLLKSLIPILIILTVFYLGWKDNQENARMFYAFIGCIISAITFPFSMRIIQK MVIRFTGKEFWQKDFFTNPVGGSLTAIFELFCFVISVPVVAIYLIFILCKALSGK
Uniprot No.

Target Background

Function
This protein is capable of protecting a cell harboring the plasmid IncI1 ColIb-P9 encoding colicin Ib against colicin Ib.
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the structural basis for Colicin Ib immunity protein specificity?

The immunity protein α1–α2 motif serves as a unique structurally-dissimilar element that restricts interaction specificity towards all colicins/pyocins. This motif combines with an extensive array of electrostatic and polar interactions to achieve both exquisite specificity and ultra-high affinity in these interactions. Analysis of native and engineered complexes has revealed that the divergence of contributing colicin residues is reciprocal to residue conservation in immunity proteins. The structurally-dissimilar immunity protein α1–α2 motif is recognized by different colicins in a similar way, while the conserved immunity protein α3 helix interacts with diverse colicin residues .

How is the colicin Ib gene organized in relation to its immunity protein gene?

The colicin Ib gene and its immunity gene (imm) are encoded on the low-copy-number plasmid ColIb-P9 and are organized in an operon structure. Importantly, the immunity gene is transcribed in the opposite direction from the pore-forming colicin-producing gene (cib). This bidirectional transcription arrangement is critical for the regulation of both genes. Physical mapping studies of cloned colicin Ia and colicin Ib genes show significant structural similarities, which have enabled the construction of hybrid genes linking the N-terminus of one colicin to the C-terminus of the other .

What is the relationship between colicin structure and immunity recognition?

Analysis of chimeric colicins formed by fusing parts of colicin Ia and Ib genes has revealed that the information necessary for immunity recognition resides in the C-terminal half of the colicin proteins. This localization of immunity recognition elements is crucial for understanding how immunity proteins interact with their specific colicin partners. The regional specificity of the immunity recognition domain has important implications for the evolution of colicin-immunity protein pairs and for engineering novel colicin-immunity systems .

How do environmental conditions affect colicin Ib expression and immunity protein regulation?

Colicin Ib expression is tightly regulated by two primary repressors: LexA (responding to DNA damage) and Fur (responding to iron limitation). Single-cell analysis using GFP reporters has revealed fascinating insights into this regulation:

Environmental ConditionPercentage of Cells Expressing cibFluorescence IntensityPrimary Regulator Affected
Standard conditionsSmall fractionLowBoth LexA and Fur active
DNA damage (Mitomycin C)Increased fractionLowLexA inactivated
Iron limitation (DTPA)Increased fractionLowFur inactivated
Combined conditionsMajority of populationHighBoth repressors inactivated

This dual repressor system creates a condition-dependent expression pattern that confines cib expression to specific subsets of the bacterial population under various environmental conditions. Only when both repressors are inactivated simultaneously does the majority of the population express high levels of colicin Ib .

How does inflammation influence colicin Ib-dependent bacterial competition?

Inflammatory conditions in the gut microenvironment significantly potentiate the effects of colicins through two primary mechanisms:

  • Increased production: Inflammation triggers the SOS response and alters iron availability, both of which enhance colicin Ib production.

  • Enhanced competitor susceptibility: Inflammatory conditions increase the susceptibility of competing bacteria to colicin activity.

Experimental evidence from mouse colitis models demonstrates that a pathogenic Salmonella Typhimurium strain only shows a significant competitive advantage from ColIb production against commensal E. coli during gut inflammation. In the absence of inflammation, ColIb production confers no apparent competitive advantage. This relationship between inflammation and colicin effectiveness has profound implications for understanding bacterial population dynamics during enteric infections .

Why are some Salmonella strains resistant to colicin Ib despite lacking the immunity gene?

Contrary to the general assumption that the immunity gene is essential for protection against colicin toxicity, research has revealed that certain Salmonella Typhimurium strains (including invasive non-typhoidal strain D23580 and Δcib:imm mutants of strain SL1344) exhibit resistance to colicin Ib even without the immunity protein. When grown in colicin-rich conditioned media from colicin-producing strains, these immunity-deficient strains showed comparable growth to control conditions. This suggests the existence of alternative protection mechanisms independent of the canonical immunity protein. Understanding these alternative resistance mechanisms has significant implications for predicting bacterial competition outcomes in complex microbial communities .

What are effective approaches for studying colicin Ib expression at the single-cell level?

Single-cell analysis of colicin Ib expression has been successfully achieved using GFP reporters for the colicin Ib promoter (Pcib). Comparative analysis of single-copy and multicopy gfp-reporters revealed that multicopy reporters yield optimal signal intensity for diverse applications. Key methodological considerations include:

  • Reporter validation: Ensuring GFP expression correlates well with colicin Ib protein levels in individual cells.

  • Induction protocols:

    • DNA damage induction: Mitomycin C at 0.25 μg/ml

    • Iron limitation: 100 μM diethylenetriaminepentaacetic acid (DTPA)

    • Combined induction: Application of both agents simultaneously

  • Data analysis: Measuring both the fraction of GFP-positive cells and fluorescence intensity to fully characterize the population response.

This reporter system is particularly valuable for investigating the costs and benefits of ColIb production in human pathogenic S. Typhimurium and analyzing cib expression under environmental conditions encountered in the mammalian gut .

How can recombinant Colicin-Ib immunity protein be optimally stored and handled for experimental use?

Recombinant Colicin-Ib immunity protein should be stored according to the following guidelines to maintain stability and activity:

  • Storage temperature: Store at -20°C for regular use, or at -80°C for extended storage periods.

  • Formulation: The protein is typically supplied in liquid form containing glycerol, which helps maintain stability during freeze-thaw cycles.

  • Freeze-thaw management: Repeated freezing and thawing should be avoided. For ongoing experiments, working aliquots should be stored at 4°C for up to one week.

These handling protocols are essential for ensuring experimental reproducibility and maintaining protein integrity throughout research applications .

What techniques are most effective for studying the structural determinants of colicin-immunity protein interactions?

Comparative structure-based energy calculations have proven valuable for mapping residues that substantially contribute to interactions across native and engineered complexes of colicins/pyocins and immunity proteins. This approach involves:

  • Structural analysis: Detailed examination of interaction interfaces using crystallographic data.

  • Energy calculations: Quantitative determination of binding energetics for specific residue interactions.

  • Mutational analysis: Creation of engineered complexes with specific mutations to validate structural predictions.

  • Electrostatic mapping: Identification of key electrostatic/polar interactions that contribute to specificity and affinity.

This combination of techniques has successfully identified the immunity protein α1–α2 motif as a critical determinant of interaction specificity, with implications for rational engineering of these interfaces and potential drug development targeting these interactions .

How can understanding colicin-immunity protein systems inform bacterial competition models in the gut microbiome?

Colicin-mediated bacterial competition represents a crucial mechanism influencing microbial community structure and dynamics. Research has revealed that approximately half of human gut microbiome genomes encode putative bacteriocins, suggesting their significant role in colonization resistance against competing pathogens. Key research considerations include:

  • Environmental context: Studies must account for gut inflammation status, as inflammation significantly potentiates colicin-mediated competition.

  • Strain distribution analysis: Genomic analyses have revealed that approximately 11% of Salmonella Typhimurium genomes carry the cib and imm genes, with significant variations between lineages associated with gastroenteritis versus invasive disease.

  • Beyond canonical immunity: Research should address alternative protection mechanisms, as some strains exhibit colicin resistance without the canonical immunity protein.

Integrating these factors into ecological models will provide more accurate predictions of bacterial population dynamics during health and disease states .

What are the implications of colicin-immunity protein interactions for designing antimicrobial strategies?

The ultra-high affinity and exquisite specificity of colicin-immunity protein interactions offer valuable insights for developing novel antimicrobial approaches:

  • Engineered colicins: Understanding the structural basis of specificity allows for the design of modified colicins with altered target ranges or enhanced activity.

  • Competitive inhibition strategies: Knowledge of immunity protein binding mechanisms could inform the development of small molecules that disrupt immunity protection, potentially sensitizing pathogens to their own toxins.

  • Target selectivity: The molecular basis for target recognition and specificity could guide the design of antimicrobials that selectively target specific bacterial species while sparing beneficial microbiota.

These applications represent promising avenues for addressing the growing challenge of antimicrobial resistance in clinical settings .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.