Recombinant Escherichia coli Colicin-Ib (cib)

Shipped with Ice Packs
In Stock

Description

Introduction to Colicin-Ib

Colicin Ib (ColIb) belongs to the Group B colicin family, a class of bacteriocins produced primarily by members of the Enterobacteriaceae family. Unlike Group A colicins which utilize the Tol system for cellular entry, Group B colicins like ColIb enter target cells via the Ton system . ColIb was initially identified in E. coli but has since been demonstrated in several pathogenic bacteria including Salmonella Typhimurium and Shigella sonnei .

The importance of ColIb in bacterial competition has been increasingly recognized, particularly in inflammatory conditions where it provides a competitive advantage to producing organisms. The cib gene, which encodes ColIb, is carried on the pCol1B9 plasmid in S. Typhimurium SL1344, alongside the cognate immunity gene (imm) that protects the producing organism from self-toxicity . This natural genetic arrangement ensures the survival of colicin-producing bacteria while enabling them to target competitors.

In natural environments, particularly within the mammalian gut, ColIb plays a significant role in shaping microbial community composition, especially during inflammatory conditions when iron becomes limited and the SOS response is triggered in bacterial populations .

Release Mechanisms of Colicin-Ib

Unlike Group A colicins, which encode specific lysis proteins for their release, Group B colicins like ColIb do not contain dedicated genes for cellular lysis. This has raised questions about how these toxins are released from producing cells . Recent research has elucidated that ColIb release occurs primarily in the context of phage-mediated lysis in S. Typhimurium.

Studies have demonstrated that ColIb is released only upon induction of the SOS response, such as through treatment with the antibiotic mitomycin C, which causes DNA damage and triggers the lytic cycle of temperate phages residing in the bacterial chromosome . S. Typhimurium harbors four temperate phages: Gifsy-1, Gifsy-2, SopEΦ, and ST64B, with ST64B contributing most significantly to ColIb release through phage-mediated lysis .

This release mechanism highlights the intricate relationship between bacterial defense systems, phage activity, and competitive strategies in microbial communities. Prophage-deficient S. Typhimurium releases significantly less ColIb, which correlates with reduced lysis in response to SOS-stress, confirming the essential role of phage-mediated lysis in ColIb release .

Biological Activities and Effects of Colicin-Ib

ColIb produced by S. Typhimurium exerts potent inhibitory effects on E. coli growth, as demonstrated in both rich medium (LB broth) and in vivo in mouse intestines . The inhibitory action depends critically on the interaction between ColIb and the CirA receptor, as evidenced by studies using E. coli with truncated cirA (cirA tr), which showed normal growth even in the presence of ColIb .

One particularly interesting effect of ColIb activity is the release of active β-galactosidase from lysed E. coli cells. Studies have shown that this enzyme release contributes to bacterial cross-feeding by making galactose more accessible to S. enterica . Transcriptional analysis revealed elevated expression of S. enterica's galactose transporters (mglB and galP) in co-cultures with colicin-producing strains compared to non-producing mutants, confirming increased galactose availability in the medium .

The relationship between ColIb activity and nutrient availability creates a complex ecological dynamic where toxin production not only eliminates competitors but also potentially enhances nutrient availability for the producing organism through the lysis of target cells.

Conditionβ-galactosidase ReleaseE. coli GrowthS. enterica Growth
E. coli monocultureLowNormalN/A
E. coli + S. enterica ΔcibColIb-deficient)LowNormalSupported
E. coli cirA tr + S. enterica WTLowNormalSupported
E. coli WT + S. enterica WTHighInhibitedEnhanced

Resistance Mechanisms Against Colicin-Ib

Despite the potency of ColIb, target bacteria can develop resistance through various mechanisms. Experimental studies have demonstrated that initially sensitive E. coli populations rapidly evolve resistance when co-cultured with ColIb-producing S. enterica .

Two primary resistance mechanisms have been identified:

  1. Spontaneous mutations in the cirA gene, resulting in truncated or non-functional CirA receptors that can no longer bind ColIb. Whole-genome sequencing of resistant clones revealed frameshift mutations dramatically shortening the CirA protein from 663 to 269 amino acids .

  2. Horizontal acquisition of the colicin immunity gene (imm) from S. enterica, a known consequence of pCol1B9 plasmid conjugation in mixed cultures of S. enterica and E. coli .

Recombinant Production of Colicin-Ib

The recombinant production of bacteriocins in non-pathogenic E. coli strains represents a promising approach for obtaining these antimicrobial compounds for potential therapeutic and industrial applications. While the search results do not specifically address recombinant production of ColIb, parallel work with similar bacteriocins provides insights into viable production strategies.

Research with salmocin M, another bacteriocin from Salmonella species, has demonstrated successful heterologous expression in E. coli Rossetta (λDE3) host cells . This approach involved cloning the bacteriocin gene into an expression vector under the control of the T7 promoter, followed by successful overexpression and purification of the active protein .

The purified recombinant bacteriocin demonstrated antimicrobial activity against both Salmonella and E. coli strains in a concentration-dependent manner, with Salmonella strains generally showing higher susceptibility . This differential sensitivity pattern mirrors what has been observed with naturally produced ColIb, suggesting that recombinantly produced colicins likely retain their natural targeting preferences.

Applications and Future Perspectives

The potent and specific antimicrobial activity of ColIb against members of the Enterobacteriaceae family suggests potential applications in various fields:

  1. Development of novel antimicrobial agents to address the growing problem of antibiotic resistance, particularly for infections caused by pathogenic E. coli.

  2. Food safety applications, where ColIb could be used to target foodborne pathogens while potentially leaving beneficial microbiota unaffected.

  3. Research tools for studying bacterial competition and community dynamics in complex microbial ecosystems.

Future research directions should include:

  • Optimization of expression systems for improved yield and activity of recombinant ColIb

  • Investigation of combination strategies to delay resistance development

  • In-depth characterization of structural and functional properties to enable protein engineering for enhanced stability and specificity

  • Assessment of safety and efficacy in relevant model systems

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please include it in your order notes and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Please note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to ensure the contents are at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize the development of your specified tag.
Synonyms
cib; Colicin-Ib
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-626
Protein Length
full length protein
Species
Escherichia coli
Target Names
cib
Target Protein Sequence
MSDPVRITNPGAESLGYDSDGHEIMAVDIYVNPPRVDVFHGTPPAWSSFGNKTIWGGNEW VDDSPTRSDIEKRDKEITAYKNTLSAQQKENENKRTEAGKRLSAAIAAREKDENTLKTLR AGNADAADITRQEFRLLQAELREYGFRTEIAGYDALRLHTESRMLFADADSLRISPREAR SLIEQAEKRQKDAQNADKKAADMLAEYERRKGILDTRLSELEKNGGAALAVLDAQQARLL GQQTRNDRAISEARNKLSSVTESLKTARNALTRAEQQLTQQKNTPDGKTIVSPEKFPGRS STNHSIVVSGDPRFAGTIKITTSAVIDNRANLNYLLTHSGLDYKRNILNDRNPVVTEDVE GDKKIYNAEVAEWDKLRQRLLDARNKITSAESAINSARNNVSARTNEQKHANDALNALLK EKENIRSQLADINQKIAEEKRKRDEINMVKDAIKLTSDFYRTIYDEFGKQASELAKELAS VSQGKQIKSVDDALNAFDKFRNNLNKKYNIQDRMAISKALEAINQVHMAENFKLFSKAFG FTGKVIERYDVAVELQKAVKTDNWRPFFVKLESLAAGRAASAVTAWAFSVMLGTPVGILG FAIIMAAVSALVNDKFIEQVNKLIGI
Uniprot No.

Target Background

Function
This colicin is a channel-forming colicin. This class of transmembrane toxins depolarizes the cytoplasmic membrane, leading to dissipation of cellular energy. Colicins are polypeptide toxins produced by and active against E. coli and closely related bacteria.
Protein Families
Channel forming colicin family
Subcellular Location
Host membrane.

Q&A

What is Colicin Ib and how does it function in bacterial competition?

Colicin Ib (ColIb) is a narrow-spectrum protein toxin produced by Salmonella enterica serovar Typhimurium (S. Tm) that specifically targets related Enterobacteriaceae, including certain E. coli strains. The protein functions as a competitive mechanism in bacterial populations, particularly in inflammation-induced intestinal environments. ColIb exerts its antimicrobial activity by binding to the outer membrane receptor CirA on susceptible bacteria, followed by translocation into the target cell where it disrupts cellular processes . Research approaches to study this competition typically involve co-infection experiments using colicin-producing and colicin-sensitive strains in animal models, with subsequent quantification of bacterial populations by selective plating techniques. Notably, comparative analysis between inflamed and non-inflamed gut environments demonstrates that ColIb-dependent competition is specifically enhanced under inflammatory conditions .

How can researchers differentiate between colicin Ib and other colicin types when studying bacterial competition?

Researchers can differentiate colicin types through multiple complementary approaches:

  • Genetic screening: PCR amplification using colicin type-specific primers can identify cib genes versus other colicin-encoding genes. Molecular characterization typically requires DNA sequence analysis of isolated colicinogenic plasmids .

  • Functional assays: Colicin Ib can be distinguished by its specific inhibitory spectrum, which differs from other colicins. For example, while colicin Z selectively inhibits enteroinvasive E. coli (EIEC) and Shigella strains, ColIb has a broader spectrum against various E. coli strains .

  • Receptor dependency testing: The requirement for specific receptors (CirA for ColIb) can be confirmed using receptor deletion mutants in inhibition assays .

  • Immunity protein analysis: Each colicin has a specific immunity protein that protects producer cells, which can be identified through genetic and protein expression studies .

The methodological approach should include control experiments with characterized colicin-producing strains and sequencing verification of identified genes to ensure accurate identification .

What conditions trigger colicin Ib expression in bacterial populations?

Colicin Ib expression is regulated by multiple environmental conditions:

Regulatory FactorEffect on cib ExpressionDetection Method
Iron limitationUpregulationqRT-PCR with reporter constructs under varying iron concentrations
SOS responseUpregulationDNA damage induction via mitomycin C treatment with subsequent expression analysis
Intestinal inflammationUpregulationIn vivo detection using cib-reporter strains in colitis models
Growth phaseVariable (species-dependent)Time-course expression studies during bacterial growth

Methodologically, researchers should employ transcriptional fusion reporters (such as luciferase or fluorescent proteins linked to the cib promoter) to monitor expression levels under different conditions . Iron-dependent regulation can be studied using iron chelators (e.g., 2,2'-dipyridyl) and supplementation experiments, while SOS induction typically utilizes mitomycin C or UV exposure. For accurate quantification, RNA isolation followed by quantitative RT-PCR remains the gold standard .

How does gut inflammation specifically enhance colicin Ib-dependent competition?

Inflammation creates a specialized niche that enhances ColIb-dependent competition through multiple mechanisms:

  • Increased cib expression: In vivo studies using the S. Tm mouse colitis model demonstrate significant upregulation of cib expression under inflammatory conditions, likely due to inflammation-associated iron limitation .

  • Enhanced receptor expression: Similarly, the CirA receptor on target E. coli cells is upregulated during inflammation, making target cells more susceptible .

  • Increased cellular susceptibility: Low iron concentrations in inflamed environments lead to increased ColIb-sensitivity of E. coli .

  • Creation of ecological opportunity: Inflammation-induced Enterobacteriaceae blooms provide a growth environment where colicin-producing bacteria can effectively compete .

To study these effects, researchers should utilize transcriptional reporters for both cib and cirA in parallel, and compare competition dynamics between wild-type and avirulent S. Tm strains that cannot trigger inflammation, as demonstrated in published studies. Quantification of bacterial competition can be performed through selective plating and calculation of competitive indices under different inflammatory conditions .

What is the relationship between prophages and colicin Ib release in S. Typhimurium?

The release mechanism of colicin Ib involves a complex relationship with prophages residing in the S. Typhimurium genome. Key findings from research indicate:

  • ColIb release is significantly increased following SOS response induction with mitomycin C, which simultaneously activates the lytic cycle of temperate phages .

  • Prophage-deficient S. Tm strains demonstrate significantly reduced ColIb release, correlating with reduced lysis in response to SOS stress .

  • Different prophages contribute unequally to this process, with ST64B contributing most significantly to ColIb release .

The methodological approach to investigating this relationship includes: (1) creating single and multiple prophage deletion mutants, (2) quantifying ColIb release by activity assays against sensitive indicator strains following SOS induction, and (3) measuring bacterial lysis through optical density measurements and detection of cytoplasmic proteins in culture supernatants. This research demonstrates that phage-mediated lysis represents an important mechanism for the release of group B colicins like ColIb, which lack dedicated lysis proteins found in group A colicins .

How does the structure of colicin Ib influence its specificity and function?

The structural organization of colicin Ib determines its specificity and functional characteristics:

  • Domain organization: Like other colicins, ColIb possesses distinct functional domains - an N-terminal translocation domain, a central receptor binding domain, and a C-terminal activity domain .

  • Receptor specificity: The receptor binding domain interacts specifically with the CirA receptor on target cells, determining the range of susceptible bacteria .

  • C-terminal domain function: Analysis of chimeric colicins containing C-terminal regions from ColIb fused to N-terminal regions from other colicins (such as ColIa) demonstrates that the C-terminal domain contains the information necessary for immunity recognition .

  • Immunity interaction: The immunity protein (Czi) interacts specifically with the C-terminal domain of ColIb to neutralize its activity in producer cells .

To study these structural-functional relationships, researchers employ methods including: (1) creation of deletion constructs and chimeric colicins, (2) site-directed mutagenesis to modify specific residues, (3) protein purification and activity assays against sensitive strains, and (4) structural analysis through X-ray crystallography or cryo-EM. Understanding the structure-function relationship provides insights for potential engineering of colicins with modified specificity or enhanced activity .

What are the optimal methods for recombinant expression and purification of active colicin Ib?

Effective expression and purification of recombinant colicin Ib requires optimization of several parameters:

Expression Systems:

Purification Protocol:

  • Initial extraction from bacterial culture using cell lysis by sonication or French press

  • Ammonium sulfate precipitation (40-60% saturation)

  • Ion-exchange chromatography (typically cation exchange as ColIb is positively charged)

  • Size exclusion chromatography for final polishing

Activity Verification:
Functional assessment using the overlay method, where purified colicin is spotted onto a lawn of sensitive indicator strains. Activity is quantified by measuring the diameter of the inhibition zone and comparing to a standard curve .

When expressing recombinant colicin Ib, researchers should ensure the construct includes the complete functional domains and consider whether the immunity protein should be co-expressed to prevent toxic effects on the producer cells .

How can researchers effectively study colicin Ib-dependent competition in animal models?

Designing rigorous animal studies to investigate colicin Ib-dependent bacterial competition requires careful experimental setup:

Model Selection:

  • Streptomycin-treated mouse colitis model provides an established system for S. Tm colitis studies

  • Gnotobiotic mice with defined microbiota avoid interference from undefined colicin-producing commensal strains

Key Experimental Groups:

  • Co-infection with ColIb-producing strain and sensitive E. coli strain in inflammatory conditions

  • Co-infection with ColIb-deficient mutant and sensitive E. coli strain in inflammatory conditions

  • Co-infection with avirulent ColIb-producing strain and sensitive E. coli strain in non-inflammatory conditions

  • Controls for colonization dynamics of individual strains

Critical Parameters to Measure:

  • Bacterial loads of competing strains in fecal samples and intestinal contents

  • Inflammatory markers (histopathology scoring, lipocalin-2 levels, cytokine measurements)

  • In vivo gene expression using reporter constructs for cib and cirA

Recommended Approaches:

  • Use of genetic markers (antibiotic resistance genes) for selective plating and enumeration

  • Prevention of plasmid transfer between strains by using oriT-deficient plasmids

  • Inclusion of comprehensive controls including wild-type and various mutant strains to isolate specific effects

  • Time course studies to capture dynamics of competition (typically 1-7 days post-infection)

This experimental design allows researchers to specifically attribute competitive effects to colicin production rather than other factors associated with infection or inflammation .

How can understanding colicin Ib biology inform strategies for pathogen control in the gut microbiome?

Knowledge of colicin Ib biology offers several strategic approaches for pathogen control:

  • Probiotic Engineering: Commensal E. coli strains can be engineered to express colicin Ib, potentially inhibiting pathogenic Enterobacteriaceae without triggering inflammation. This approach requires careful selection of colicin-producing strains that lack virulence factors, as confirmed by genome sequencing and PCR screening for virulence genes .

  • Ecological Niche Management: Understanding the role of inflammation in enhancing colicin-dependent competition suggests that anti-inflammatory therapies could reduce the competitive advantage of pathogens like S. Typhimurium in the gut .

  • Targeted Antimicrobial Development: The specificity of colicins makes them excellent candidates for narrow-spectrum antimicrobials against specific pathogens. Research demonstrates that combinations of colicins can provide broad activity against major pathogenic E. coli strains while sparing beneficial microbiota .

  • Resistance Management: Due to the potential for resistance development, studies suggest using combinations of different colicins or modified colicin variants to overcome resistance mechanisms .

Methodological approaches for developing these strategies should include: (1) screening of colicin activity against diverse clinical isolates, (2) in vivo testing in animal models with complex microbiota, and (3) assessment of resistance development frequencies through serial passage experiments .

What factors influence the ecological dynamics of colicin Ib-producing bacteria in complex microbial communities?

The ecological dynamics of colicin Ib-producing bacteria in complex communities are influenced by multiple factors:

Environmental Factors:

  • Inflammatory state: Inflammation significantly enhances colicin-dependent competition by increasing both production and susceptibility

  • Iron availability: Low iron conditions upregulate both colicin production and receptor expression

  • SOS-inducing conditions: Environmental stressors that trigger DNA damage response enhance colicin expression

Microbial Factors:

  • Distribution of immunity genes: The prevalence of immunity genes in community members affects competitive outcomes

  • Receptor expression levels: Variation in CirA expression across species and strains determines susceptibility

  • Growth rates: Differences in bacterial replication rates affect competition dynamics

Host Factors:

  • Diet: Influences availability of critical nutrients like iron

  • Genetic background: Different pig breeds show varied enrichment of colicin genes in their gut microbiomes

  • Immune response characteristics: Type and intensity of inflammatory response

These dynamics can be studied using metagenomic analysis to track colicin gene prevalence in different host populations, alongside experimental ecology approaches that manipulate community composition and environmental conditions in controlled models. Gnotobiotic animal models with defined microbial communities represent a powerful system for isolating the effects of specific variables on colicin-mediated competition .

What are the main technical challenges in studying colicin Ib function in complex microbial communities?

Researchers face several significant technical challenges when investigating colicin Ib function in complex communities:

  • Selective detection and quantification: Developing methods to specifically track colicin production in situ within complex communities remains difficult. Current approaches using transcriptional reporters may not accurately reflect actual protein levels or activity.

  • Single-cell resolution: Most current methods measure population-level effects, but colicin activity likely creates micro-environmental heterogeneity that requires single-cell analysis methods.

  • Temporal dynamics: Capturing the rapid kinetics of colicin production, release, and activity requires time-resolved measurement techniques that are challenging to implement in vivo.

  • Confounding factors: Separating the effects of colicin-mediated competition from other competitive mechanisms in complex communities requires sophisticated experimental controls.

  • Genetic manipulation limitations: Creating multiple genetic variants in non-model organisms that produce colicins remains technically challenging.

Methodological approaches to address these challenges include developing more sensitive biosensors for colicin activity, implementing single-cell RNA sequencing to capture heterogeneity, using microfluidic systems for controlled community studies, and applying computational modeling to integrate experimental data across scales .

What are promising future research directions for recombinant colicin Ib applications?

Several promising research directions for recombinant colicin Ib merit further investigation:

  • Engineered specificity: Modifying the receptor binding domain of colicin Ib could redirect its activity toward specific pathogens while sparing beneficial bacteria. This approach requires detailed structure-function analysis and rational protein engineering.

  • Delivery systems development: Encapsulation technologies could protect colicins from degradation and deliver them specifically to intestinal locations where pathogenic Enterobacteriaceae reside.

  • Plant-based production systems: Further optimization of plant expression systems could enable cost-effective, large-scale production of colicins for research and potential therapeutic applications .

  • Combination therapies: Research into synergistic combinations of colicin Ib with other colicins or conventional antimicrobials could enhance efficacy and reduce resistance development .

  • Microbiome modulators: Development of colicin-producing probiotics that can modulate microbiome composition in a targeted manner, particularly in inflammatory conditions that favor Enterobacteriaceae blooms .

  • Phage-colicin combinations: Investigating the potential synergy between colicins and bacteriophages, particularly leveraging the relationship between prophage activation and colicin release .

The methodological approach should include interdisciplinary collaboration between structural biologists, microbiologists, and bioengineers to address these complex challenges. Initial studies in simplified in vitro systems should progress to animal models that accurately recapitulate human intestinal conditions before clinical translation .

Comparison of colicin Ib with other major colicin types

Colicin TypeProducerTarget SpecificityReceptorKilling MechanismRegulated ByImmunity Protein
Colicin IbS. TyphimuriumEnterobacteriaceaeCirAPore formationIron limitation, SOS responseCib immunity protein
Colicin BE. coliE. coli strainsFepAPore formationIron limitationCib immunity protein
Colicin ME. coliE. coli strainsFhuAInhibition of peptidoglycan synthesisIron limitationCim immunity protein
Colicin E7E. coliE. coli strainsBtuBDNase activitySOS responseCei immunity protein
Colicin ZE. coli B1356EIEC and ShigellaCjrCNot fully characterizedNot fully characterizedCzi immunity protein

This comparison is derived from synthesizing data across multiple research sources .

Experimental evidence for colicin Ib activity under different conditions

Experimental ConditionColIb ProductionTarget SusceptibilityCompetitive AdvantageKey Findings
In vitro growth (iron-rich)LowLowMinimalColIb provides minimal competitive advantage under standard laboratory conditions
In vitro growth (iron-limited)HighHighModerateIron limitation increases both ColIb production and target susceptibility
In vivo (non-inflamed gut)LowLowNoneAvirulent S. Tm strains showed no ColIb-dependent competitive advantage
In vivo (inflamed gut)HighHighSignificantInflammation creates conditions that potentiate ColIb effects through increased production and susceptibility
In vivo with prophage-deficient S. TmReduced releaseHighReducedST64B prophage contributes significantly to ColIb release

This table summarizes the key experimental findings from multiple studies on the conditions affecting colicin Ib activity .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.