Recombinant Colicin-K (cka)

Shipped with Ice Packs
In Stock

Description

Genetic Framework

The genetic organization of Colicin K involves a cluster of three essential genes encoding for different aspects of colicin production and function:

  • cka: Encodes the colicin activity protein

  • cki: Encodes the immunity protein that protects the producing cell

  • ckl: Encodes the lysis protein required for release of colicin

Sequencing of the colicin K-encoding plasmid pColK-K235 has revealed a mosaic structure featuring the insertion sequence IS2, indicating potential horizontal gene transfer events in its evolutionary history .

Genetic ElementFunctionLocation
cka geneEncodes active colicin proteinColE1-like plasmid
cki geneProvides immunity to producerAdjacent to cka
ckl geneFacilitates release through cell lysisDownstream of activity gene

Expression Systems and Methodology

Recombinant Colicin-K production typically involves cloning the cka gene into appropriate expression vectors followed by transformation into E. coli host strains. Research demonstrates successful expression using the pET vector system, specifically with the cka gene inserted into pET8c and expressed in E. coli BL21(DE3) . The amplification of the cka activity gene can be achieved through PCR using specific primers, with subsequent enzymatic digestion and ligation into the expression vector .

Alternative approaches include fusion of the N-terminal domain of colicin K with signal sequences for periplasmic targeting, allowing for the study of interactions between the colicin translocation domain and cellular components .

Purification and Physical Properties

Commercial preparations of recombinant Colicin-K typically feature fusion tags to facilitate purification:

  • His-tagged full-length protein (residues 1-548)

  • Expressed in E. coli expression systems

  • Purified to >90% homogeneity as determined by SDS-PAGE

  • Available in lyophilized form with Tris/PBS-based buffer containing 6% trehalose at pH 8.0

For research applications, protein purification involves chromatographic techniques following expression. The purified protein should be stored at -20°C/-80°C, with recommendation for reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL with 5-50% glycerol for long-term stability .

Receptor Binding and Membrane Penetration

Colicin K demonstrates a sophisticated multi-step mechanism for targeting and entering susceptible cells. The process begins with binding to the Tsx nucleoside-specific receptor at the bacterial cell surface, followed by translocation through the outer membrane via the OmpA protein . Subsequently, the N-terminal domain facilitates transit through the periplasmic space by interacting with components of the Tol system.

In vitro and in vivo experiments have confirmed that Colicin K requires the complete complement of Tol proteins for successful translocation:

ComponentRole in Colicin K Translocation
TolADirect interaction with N-terminal domain
TolBRequired despite absence of conventional TolB box
TolQFirst reported colicin-TolQ interaction
TolREssential for successful translocation

These interactions have been demonstrated through coimmunoprecipitation and pulldown experiments, revealing that the N-terminal domain of Colicin K (KT) interacts with TolA, TolB, and TolR proteins . Notably, research with Colicin K has identified, for the first time, an interaction between a colicin translocation domain and the TolQ protein, expanding our understanding of colicin translocation mechanisms .

Bactericidal Action

As a pore-forming colicin, the C-terminal domain of Colicin K integrates into the inner membrane of target cells, creating voltage-gated channels that disrupt membrane potential and ultimately lead to cell death through energy depletion and leakage of cellular contents.

Environmental Control Mechanisms

The expression of the colicin K structural gene (cka) is subject to complex regulation influenced by multiple environmental factors. Studies utilizing cka-lacZ fusion constructs have identified several key regulatory signals:

  1. Growth phase dependence with peak expression in late stationary phase

  2. Induction by nutrient depletion via increased ppGpp levels

  3. Strong temperature sensitivity with minimal expression at 22°C

  4. Partial regulation by the SOS response independent of ppGpp

  5. Partial induction by increased osmolarity

  6. Inhibition by integration host factor (IHF) during late stationary phase

Interestingly, cka expression operates independently of several regulatory systems that control other colicins:

  • Cyclic AMP-Crp complex

  • Carbon source

  • RpoS

  • Lrp

  • H-NS

  • pH

  • Short-chain fatty acids

Unlike colicin E1, cka expression shows independence from catabolite repression and is only partially affected by anaerobiosis during SOS induction . This distinct regulatory profile suggests that while different colicins respond to common signals like nutrient depletion, individual colicins may also be influenced by specific environmental cues, potentially reflecting ecological specialization.

Efficacy Against Uropathogenic E. coli

Research has demonstrated that Colicin K exhibits pronounced inhibitory activity against uropathogenic E. coli (UPEC) strains, positioning it as a potential therapeutic agent for urinary tract infections . A quantitative analysis of minimum inhibitory concentrations against 215 UPEC isolates revealed significant antimicrobial efficacy, although the prevalence of natural colicin K production among these strains was relatively low .

Therapeutic Potential

The emergence of antimicrobial resistance has stimulated renewed interest in bacteriocins like colicins as alternative approaches to conventional antibiotics. Potential applications for Colicin K include:

  1. Prevention and treatment of E. coli-associated infections

  2. Control of diarrheal diseases, including those caused by pathogenic serotypes like O157:H7

  3. Management of postweaning diarrhea and edema disease in swine

  4. Prevention of bacterial colonization on urinary catheters

These applications leverage the specific targeting mechanism of Colicin K against E. coli strains without affecting beneficial microbiota, potentially reducing side effects associated with broad-spectrum antibiotics.

Distribution in Natural Populations

Recent research has provided evidence that certain colicins play an antagonistic role in promoting microbial diversity within E. coli populations in the mammalian colon . This suggests that colicins like Colicin K may contribute to the maintenance of bacterial community structure and diversity in their natural habitats.

Future Research Directions

Current research on recombinant Colicin-K focuses on several promising areas:

  1. Detailed structural analysis of interactions between Colicin K and components of its translocation machinery

  2. Development of engineered variants with enhanced stability and antimicrobial activity

  3. Clinical evaluation of efficacy against multidrug-resistant E. coli infections

  4. Investigation of delivery systems for targeted therapeutic applications

  5. Further characterization of the ecological role of Colicin K in bacterial communities

As antibiotic resistance continues to pose a global health challenge, Colicin K represents a valuable addition to the arsenal of alternative antimicrobial strategies deserving of continued research investment.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
cka; Colicin-K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-548
Protein Length
full length protein
Species
Escherichia coli
Target Names
cka
Target Protein Sequence
MAKELSGYGPTAGESMGGTGANLNQQGGNNNSNSGVHWGGGSGHGNNGGQGNSNSSGSTS TVMKTGESYLTPWGDVVINNDGLPVMNGIVMTEENSTLVDNPFGGVSRVLNSLISDMPSL FAESSGNNNNNTASVNTAPTNAQVSDMDKSSKVVSNVINEKQKQKNKIATQISEKQKKIE EMKKVFKHHSYHGITDLERDVDELQKKSNQLDADISKLNSYKNTLQSKIGDVNKQKEAEE KARENAEVAEHETLNEEKQAVAEAEKRLAEAKAELAKAESDVQSKQATVSRVAGELENAQ KSVDVKVTGFPGWRDVQKKLQRQLEAKQAEYSAVENELKNAVSFRDGKAAEVKEAEQKLK EAQDALEKSQIKDAVDTMVGFYQYITEQYGEKYAKIAQDLAEKSKGKKIQGVDEALAAFE KYKNVLDKKFSKVDRDAIFNALESVNYDELSKNLTKISKSLKITSRVSFLYDVGSDFKNA IETGNWRPLFVTLEKSAVDVGVAKIVALMFSFIVGVPLGFWGIAIVTGIVSSYIGDDELS KLNELLGI
Uniprot No.

Target Background

Function
Recombinant Colicin-K (Cka) is a channel-forming colicin. These transmembrane toxins depolarize the cytoplasmic membrane, dissipating cellular energy. Colicins are polypeptide toxins produced by and active against *E. coli* and closely related bacteria.
Gene References Into Functions
  1. Studies indicate that temperature regulates *cka* expression at the transcriptional level. It is hypothesized that the SOS response indirectly influences the thermoregulation of colicin K. PMID: 18399998
Protein Families
Channel forming colicin family
Subcellular Location
Host membrane.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.