Recombinant Escherichia coli Colicin-N (cna)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
cna; Colicin-N
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-387
Protein Length
full length protein
Species
Escherichia coli
Target Names
cna
Target Protein Sequence
MGSNGADNAHNNAFGGGKNPGIGNTSGAGSNGSASSNRGNSNGWSWSNKPHKNDGFHSDG SYHITFHGDNNSKPKPGGNSGNRGNNGDGASAKVGEITITPDNSKPGRYISSNPEYSLLA KLIDAESIKGTEVYTFHTRKGQYVKVTVPDSNIDKMRVDYVNWKGPKYNNKLVKRFVSQF LLFRKEEKEKNEKEALLKASELVSGMGDKLGEYLGVKYKNVAKEVANDIKNFHGRNIRSY NEAMASLNKVLANPKMKVNKSDKDAIVNAWKQVNAKDMANKIGNLGKAFKVADLAIKVEK IREKSIEGYNTGNWGPLLLEVESWIIGGVVAGVAISLFGAVLSFLPISGLAVTALGVIGI MTISYLSSFIDANRVSNINNIISSVIR
Uniprot No.

Target Background

Function

This colicin is a channel-forming toxin. These transmembrane toxins depolarize the cytoplasmic membrane, dissipating cellular energy. Colicins are polypeptide toxins produced by and active against E. coli and closely related bacteria.

Protein Families
Channel forming colicin family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How is the expression of the cna gene regulated in bacterial cells?

The regulation of colicin N gene (cna) expression involves sophisticated DNA-damage response mechanisms. The regulatory region upstream from cna contains two tandemly-arranged and overlapping potential LexA binding sites, known as SOS boxes . This arrangement aligns with previous demonstrations that cna expression is repressed by the LexA protein . The SOS system of DNA repair in bacteria controls this process - when DNA damage occurs, RecA proteinase is activated and turns off the LexA protein, which otherwise serves as a repressor for colicin production .

Experimental deletion of the LexA binding site allows efficient transcription of cna from an upstream lacZ promoter, while its presence reduces lacZ-promoted cna expression to varying extents depending on the proximity of the promoter and SOS boxes . This regulatory system ensures that colicin production is triggered primarily under stress conditions, such as DNA damage caused by UV light or mitomycin C .

What is the primary killing mechanism of Colicin-N against bacteria?

Colicin N kills bacteria through a multistep process that culminates in inner membrane pore formation. While initially thought to cause direct cell lysis, more detailed investigations revealed that Colicin N primarily depolarizes the E. coli cytoplasmic membrane, with lysis occurring as a secondary effect . The pore-forming activity resides in the C-terminal domain, which inserts into the inner membrane and creates channels that disrupt the electrochemical gradient .

This membrane disruption can be experimentally measured through K+ efflux assays, which provide a real-time assessment of ion leakage from target cells . The minimum inhibitory concentration (MIC) of full-length Colicin N against E. coli is approximately 1 nM, demonstrating its potent antimicrobial activity . Interestingly, even truncated versions retain activity, with ColN-TR and ColN-T having MICs of 100 nM and 10 μM respectively, comparable to many known antimicrobial peptides .

How does the unstructured N-terminal domain contribute to Colicin-N function?

Contrary to traditional understanding, research has revealed that the 90-residue unstructured N-terminal domain of Colicin N possesses intrinsic cytotoxic activity . This domain causes ion leakage from cells while showing no membrane binding behavior typical of antimicrobial peptides . Its activity remains strictly dependent upon the same receptor proteins (OmpF and TolA) used by full-length colicin N .

In translocation experiments, Colicin N was found to hijack two copies of its outer membrane receptor during the process of entering the cell . The N-terminal domain contains a glycine-rich region common to many colicins, though research has shown that part of this glycine-rich domain can be replaced by an unrelated sequence lacking glycine residues without affecting either colicin release or activity . This suggests the domain's structural flexibility may be more important than its specific amino acid composition.

How do receptor interactions facilitate Colicin-N entry into bacterial cells?

Colicin N requires specific outer membrane proteins for cellular entry, particularly OmpF porin and the Tol system proteins . The translocation mechanism involves a sequential interaction with these receptor proteins, with the TolA protein playing a particularly crucial role . Specific residues within the colicin are critical for these interactions - research on the related Colicin A has shown that tyrosine 58 in the TolA box is essential for TolA binding .

The entry process demonstrates remarkable specificity, as the cytotoxic activity of even the isolated N-terminal domain remains dependent on the same receptor proteins used by the full-length toxin . This receptor-mediated mechanism represents a novel approach for membrane disruption via a soluble peptide, potentially opening new avenues for targeted antimicrobial development .

What expression systems yield optimal production of recombinant Colicin-N?

E. coli remains the predominant expression system for recombinant Colicin N production, though alternative systems including yeast, baculovirus, and mammalian cells are available . A typical E. coli expression protocol involves cloning the cna gene into a plasmid vector with an arabinose-inducible promoter . The recommended expression parameters include:

  • Selection of transformants on LB agar containing 100 μg/mL ampicillin

  • Growth of bacteria in LB media to OD600 of 0.6

  • Induction with arabinose at 0.2% (w/v) final concentration

  • Incubation for 3 hours post-induction

  • Cell harvest by centrifugation at 8000× g at 4°C for 10 minutes

Cell lysis is typically performed by resuspending the bacterial pellet in binding buffer (50 mM sodium phosphate buffer; pH 8.0, 300 mM NaCl and 10 mM imidazole), followed by addition of RNase, DNase I, and protease inhibitors, and pulse sonication for 15 minutes on ice .

What are the recommended methods for assessing Colicin-N antimicrobial activity?

Several complementary methods can be used to evaluate the antimicrobial activity of purified Colicin N:

1. Agar Overlay Assay:
This semi-quantitative method involves:

  • Growing a single colony of E. coli overnight, diluting 1/100 into fresh LB media, and incubating for 3-4 hours

  • Inoculating 100 μL of bacterial culture into 3 mL of soft agar (0.7% w/v)

  • Pouring the mixture onto solidified LB agar plates

  • After overlay solidification, spotting 2 μL of recombinant ColN (in PBS pH 7.4)

  • Incubating overnight at 37°C and observing clear zones of inhibition

2. K+ Efflux Assay:
This highly sensitive quantitative assay measures real-time release of intracellular K+ from E. coli cells exposed to Colicin N, providing direct assessment of membrane depolarization .

3. Minimum Inhibitory Concentration Determination:
MIC testing provides quantitative assessment of antimicrobial potency. Full-length Colicin N typically shows an MIC of 1 nM against susceptible E. coli strains .

4. Comparative Strain Testing:
For assessing spectrum of activity, testing against multiple strains is valuable. Research on various colicins against E. coli strains from the "Big 7" STEC serovars revealed three patterns of activity: narrow specificity (1-2 strains), moderate activity (3-4 strains), and broad spectrum activity (observed with ColM, ColIa, and ColIb) .

How can Colicin-N be engineered for enhanced anticancer activity?

This engineered variant was produced by identifying and replacing solvent-exposed Asp and Glu residues with Lys using Rosetta and AvNAPSA (Average number of Neighboring Atoms Per Sidechain Atom) computational approaches . The rationale for this modification is based on previous research showing that increasing positive charges on proteins enhances mammalian cell penetration and interaction with the negatively charged surface of cancer cells .

The engineered protein maintains its structural integrity while showing enhanced selectivity and cytotoxicity towards human lung cancer cells compared to normal cells . This approach demonstrates how structural protein engineering can repurpose a bacterial toxin for potential therapeutic applications.

How can Colicin-N be utilized in food safety applications?

Plant-produced recombinant colicins, including Colicin N, are being developed as non-antibiotic food safety interventions . These recombinant proteins match the target specificities and potency of bacterial colicins while offering advantages in terms of production scale and safety . Key features for food safety applications include:

  • Versatile formulation options: Colicins can be used individually or as mixtures depending on the target pathogen spectrum. For example, cocktails of colicins with complementary activity (such as ColM + ColIb + ColU + ColK) effectively control most pathogenic EHEC strains .

  • Multiple application methods: Colicins can be applied to fruits and vegetables as a wash, dip, or spray, or included as a package additive in ready-to-eat products .

  • Effective at low concentrations: Active against target food pathogens at use rates not exceeding 10 mg COLICIN/kg food .

  • Activity against multidrug-resistant pathogens: Colicins maintain effectiveness against antibiotic-resistant bacteria, including multidrug-resistant E. coli strains like ATCC® BAA-2326™ of serotype O104:H4, which carries numerous antibiotic resistance genes .

What characteristics distinguish Colicin-N from other pore-forming colicins?

While all pore-forming colicins share the same general mechanism of action, significant variability exists in their structures, receptor specificities, and activity profiles. The protein sequence identity among pore-forming colicins is typically around 40%, indicating substantial diversity within this functional class . Specific distinguishing features of Colicin N include:

  • Size and structure: Colicin N is the smallest colicin, which provides advantages for tumor penetration and reduced immunogenicity in potential therapeutic applications .

  • Receptor requirements: Colicin N specifically requires the OmpF porin as its outer membrane receptor , whereas other colicins may utilize different outer membrane proteins.

  • Domain homology: The carboxy-terminal half of colicin N exhibits significant homology to the C-terminus of colicin A, suggesting evolutionary relationships between these pore-forming toxins .

  • Unique N-terminal activity: Unlike other colicins, the isolated unstructured N-terminal domain of Colicin N demonstrates intrinsic cytotoxic activity, causing ion leakage from cells while maintaining dependency on the same receptor proteins used by the full-length toxin .

What evolutionary processes drive Colicin-N diversification and specificity?

The evolution of colicins involves two primary mechanisms: positive selection and recombination . Positive selection drives diversity through an evolutionary process whereby mutations in immunity genes confer broader protective functions, leading to the emergence of "super killer" colicins that provide significant competitive advantages . This process explains the high degree of variation seen in colicin immunity components.

Recombination processes, operating both within and between pore-forming colicin groups, reassemble gene sequences coding for different functional domains to generate novel colicin types . This explains the approximately 40% protein sequence identity observed among pore-forming colicins, including Colicin N .

Based on DNA and protein sequence similarities, pore-forming colicins represent a diverse class of proteins with a common evolutionary ancestor, with their diversification resulting from multiple recombination events selecting functional domains to create novel toxin types . These evolutionary mechanisms help explain the rich diversity of colicin specificity and activity observed in nature.

How do bacteria develop resistance to Colicin-N, and what countermeasures exist?

Bacterial resistance to colicins typically develops through several potential mechanisms:

  • Immunity protein expression: Colicin-producing bacteria protect themselves by co-expressing immunity proteins (like cni for Colicin N) that bind with high affinity to their cognate colicins, inhibiting their cytotoxic activity .

  • Receptor modification: Since Colicin N requires specific outer membrane proteins (OmpF) and the Tol system for entry , mutations affecting these receptors can confer resistance.

  • Plasmid acquisition: The genes for colicin immunity can be horizontally transferred via plasmids, potentially spreading resistance through bacterial populations.

To counter resistance development, research has focused on creating colicin cocktails with complementary activity spectra. For example, combinations like ColM + ColIb + ColU + ColK can effectively control a broader range of pathogenic strains than single colicins . This approach exploits the different receptor requirements and mechanisms of various colicins, making simultaneous resistance to multiple colicins much less likely to develop.

What contradictions exist in current Colicin-N research, and how might they be resolved?

While the search results don't highlight specific contradictions in Colicin-N research, several areas of uncertainty warrant further investigation:

  • Mechanism of N-terminal domain toxicity: The discovery that the unstructured N-terminal domain of Colicin N is itself cytotoxic challenges the traditional understanding of colicin function. Further research is needed to elucidate precisely how this domain disrupts membranes while showing no membrane binding behavior typical of antimicrobial peptides.

  • Glycine-rich domain function: While Colicin N contains a glycine-rich amino terminus similar to other colicins, research has shown this can be replaced without affecting function . This raises questions about the evolutionary conservation of this feature if it's not critical for activity.

  • Cancer cell specificity mechanisms: The selective toxicity of Colicin N toward cancer cells versus normal cells requires further mechanistic elucidation to optimize its potential therapeutic applications.

Resolving these questions will likely require integrated approaches combining structural biology, molecular genetics, and advanced imaging techniques to visualize the interactions between Colicin N domains and their cellular targets.

What novel research directions might expand Colicin-N applications beyond current uses?

Several promising research directions could significantly expand Colicin-N applications:

  • Targeted cancer therapeutics: Building on the selective apoptosis-inducing effect in human lung cancer cells , researchers could further engineer Colicin N with cancer-specific targeting moieties to enhance selectivity and potency.

  • Antibiotic potentiation: Research has shown that Colicin E1 fragments binding to TolC can plug this channel, inhibiting its function as an antibiotic efflux pump and heightening bacterial susceptibility to multiple antibiotic classes . Similar approaches could be explored with Colicin N against different membrane proteins.

  • Synthetic biology scaffolds: The modular domain structure of Colicin N makes it an attractive scaffold for synthetic biology applications, potentially allowing the creation of chimeric proteins with novel functions by replacing or adding functional domains.

  • Nanoparticle delivery systems: Combining Colicin N with nanoparticle delivery systems could enhance its stability, targeting, and therapeutic efficacy for both antimicrobial and anticancer applications.

  • Gut microbiome modulation: Given the specificity of Colicin N for E. coli, it could potentially be developed as a tool for targeted modulation of gut microbiota, selectively eliminating pathogenic E. coli while sparing beneficial bacterial populations.

Each of these directions would require sophisticated experimental approaches but could significantly expand the therapeutic and biotechnological applications of this fascinating bacterial toxin.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.