Recombinant Colletotrichum gloeosporioides Tubulin beta-1 chain (TUB1)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization of C. gloeosporioides TUB1

The TUB1 gene encodes a β-tubulin isoform essential for microtubule formation. Key findings include:

Table 1: Homology comparison of TUB1 β-tubulin sequences

SpeciesSequence Similarity to C. gloeosporioides TUB1Functional Relevance
C. graminicola92.7%Microtubule stability
C. gloeosporioides f. sp. aeschynomene100%Fungicide binding
Fusarium graminearum β1-tubulin76%Carbendazim resistance

Functional Roles in Fungal Biology

TUB1 is indispensable for vegetative growth, conidiation, and pathogenicity:

  • Growth Regulation: Deletion of TUB1-associated genes (e.g., CgNPG1) reduces mycelial growth rates by 19% (P < 0.05) and alters conidial morphology .

  • Pathogenicity: Strains with disrupted TUB1-related pathways show 50% reduced lesion diameters in plant infection assays, linked to impaired appressorium formation and conidial germination .

  • Fungicide Resistance: Mutations in β-tubulin genes (e.g., amino acid substitutions at residues 167, 198, or 200) confer resistance to benzimidazole fungicides like benomyl and carbendazim .

Applications in Fungicide Development

Recombinant TUB1 serves as a target for antifungal research:

  • Binding Studies: β1-tubulin is the primary binding target for carbendazim in F. graminearum, with 87% reduction in β1 levels under high fungicide exposure .

  • Resistance Screening: PCR amplification of TUB1 regions (e.g., primers GENC/TUB2B) enables rapid detection of benomyl-resistant C. gloeosporioides isolates .

Table 2: Impact of TUB1 modulation on fungal phenotypes

ModificationEffect on GrowthEffect on PathogenicityConidiation Change
CgNPG1 deletion↓ 19%↓ 50% lesion size↓ 30%
CgNPG1 heterologous expression↑ 25%↑ 60% disease severity↑ 40%
Benomyl-resistant TUB1 mutantsNo changeResistant to fungicidesUnaffected

Research Implications

  • Genetic Engineering: Heterologous expression of TUB1 in C. acutatum enhances pathogenicity by upregulating calcium signaling (CaCRZ1) and MAP kinase (CaCMK1) pathways .

  • Comparative Genomics: Phylogenetic analyses reveal conserved β-tubulin domains across Colletotrichum spp., aiding in species-specific fungicide design .

Challenges and Future Directions

  • Functional Redundancy: The presence of β2-tubulin isoforms may compensate for TUB1 mutations, complicating resistance management .

  • Structural Studies: Cryo-EM or X-ray crystallography of recombinant TUB1 could elucidate benzimidazole-binding mechanisms .

Product Specs

Form
Lyophilized powder. We will preferentially ship the format we have in stock. If you have special format requirements, please note them when ordering, and we will fulfill your request.
Lead Time
Delivery times vary depending on purchase method and location. Please consult your local distributor for specific delivery times. All proteins are shipped with normal blue ice packs by default. If you require dry ice shipping, please contact us in advance as extra fees will apply.
Notes
Avoid repeated freezing and thawing. Working aliquots can be stored at 4°C for up to one week.
Reconstitution
Briefly centrifuge the vial before opening to ensure contents are at the bottom. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% for your reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer components, storage temperature, and protein stability. Generally, the liquid form has a shelf life of 6 months at -20°C/-80°C, while the lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
TUB1; Tubulin beta-1 chain; Beta-1-tubulin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-448
Protein Length
full length protein
Purity
>85% (SDS-PAGE)
Species
Colletotrichum gloeosporioides (Anthracnose fungus) (Glomerella cingulata)
Target Names
TUB1
Target Protein Sequence
MREIIHLQTGQCLIQGNQVGTAFWQTIHHEHGLDHDGYFRGESTQQSDRLSVYFAEASNN KYVPRAVLVDLEPATMDAIRSGPLGNFFRPDNMVHGQSGAGNNWAKGHYTEGAELVDQVL DVVRREAETCDSLQGFQITHSLGGGTGSGMGTLLIAKVREEFPDRMMATFSVLPSPKVSE VVVEPYNATLSVHQLVENSDETFCIDNEALYDICRRTLKQAHPSYGDLNKLVSRVMSGLT TGFRFPGQLNADLRKLAVNLVPFPRLHFFTVGFAPLTTAAAYQNLGVAELTQQMFDPKNV MSASDFRNGRFLTCSAIYRGKVSTKQIEEQIRGVQAKNSAYFVEWIPNNVQTAHCSIPPV GMNASSTFIGNSTAIQDIFRRVGDQFSVMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLV SEYQQYQDAGMDDDEAEEAYEEEEPVEE
Uniprot No.

Target Background

Function
Tubulin is the main component of microtubules. It binds two GTP molecules: one at an exchangeable site on the beta chain and another at a non-exchangeable site on the alpha chain.
Protein Families
Tubulin family
Subcellular Location
Cytoplasm, cytoskeleton.

Q&A

What is the TUB1 gene in Colletotrichum gloeosporioides and what is its biological function?

The TUB1 gene in Colletotrichum gloeosporioides encodes a β-tubulin protein, which is a fundamental component of microtubules in the fungal cytoskeleton. These microtubules play essential roles in various cellular processes including mitosis, cellular transport, and maintaining cell structure. The gene has been isolated, cloned, and sequenced, showing high homology to the TUB1 gene of Colletotrichum graminicola . C. gloeosporioides f. sp. aeschynomene is used as a commercial mycoherbicide for rice and soybeans, making the understanding of its cytoskeletal genes particularly important for applications in biological control .

How does the structure of the TUB1 gene in C. gloeosporioides compare to tubulin genes in other organisms?

The coding sequence and deduced amino acid sequence of the C. gloeosporioides TUB1 gene shows high homology to the TUB1 gene of Colletotrichum graminicola . This reflects the evolutionary conservation of tubulin proteins across fungal species. Southern hybridization analyses suggest that C. gloeosporioides contains two TUB genes , which differs from the organization in Saccharomyces cerevisiae, where TUB1 is the major gene encoding α-tubulin (not β-tubulin), TUB3 is a second α-tubulin gene expressed at lower levels, and TUB2 is the only gene encoding β-tubulin . This difference in genetic organization reflects the diverse evolutionary paths of tubulin genes across fungal species.

What are the standard methods for isolating and cloning the TUB1 gene from C. gloeosporioides?

The isolation and cloning of the TUB1 gene from C. gloeosporioides typically involves these methodological steps:

  • Genomic DNA extraction using fungal-specific protocols

  • PCR amplification using primers designed from conserved regions of β-tubulin genes

  • Restriction enzyme digestion for preparing compatible ends (commonly using enzymes from New England Biolabs)

  • Ligation into appropriate vectors (such as pUC119)

  • Transformation into E. coli strains (such as DH5α or DH5αF')

  • Selection of transformants on appropriate media

  • Verification through restriction analysis and DNA sequencing using T7 polymerase or commercial sequencing services

These techniques have successfully been used to isolate, clone, and sequence the TUB1 gene from C. gloeosporioides f. sp. aeschynomene as documented in published research .

How many tubulin genes have been identified in C. gloeosporioides and how do they functionally differ?

Southern hybridization analyses using the C. gloeosporioides TUB1 and C. graminicola TUB2 genes as probes suggest that C. gloeosporioides contains two TUB genes . Variation in both the restriction pattern and the number of TUB genes present in different formae specialis of C. gloeosporioides has been observed . While the complete functional characterization of these genes has not been fully documented in the search results, this genetic variation is likely relevant for understanding the relationships among different formae specialis of C. gloeosporioides and may contribute to differences in host specificity and pathogenicity characteristics.

How do genetic variations in TUB1 affect the pathogenicity of different formae specialis of C. gloeosporioides?

Genetic variations in the TUB1 gene among different formae specialis of C. gloeosporioides may significantly impact their pathogenicity profiles. Research has shown variation in both restriction patterns and the number of TUB genes present in different formae specialis , which could contribute to their differing host specificities. These observations are particularly relevant for assessing relationships among formae specialis of C. gloeosporioides .

To study these variations methodologically:

  • Isolate and sequence TUB1 from multiple formae specialis

  • Perform comparative genomic analyses to identify specific sequence variations

  • Conduct pathogenicity assays on different host plants

  • Create gene replacement strains to validate the role of specific variations

  • Analyze the expression levels during infection using techniques like RT-PCR

Understanding these variations is particularly important when considering C. gloeosporioides f. sp. aeschynomene as a mycoherbicide, as genetic differences in TUB1 may affect its host range and efficacy .

What methods are used to study TUB1 gene expression during different life stages of C. gloeosporioides?

To study TUB1 gene expression during different life stages of C. gloeosporioides, researchers employ several methodological approaches:

  • RT-PCR/qRT-PCR: To quantify TUB1 mRNA levels during different developmental stages

  • RNA-Seq: For genome-wide expression analysis, including TUB1

  • Northern blotting: To detect and quantify TUB1 transcripts

  • Reporter gene assays: Using TUB1 promoter fused to reporter genes

  • Western blotting: To analyze protein levels using β-tubulin-specific antibodies

  • Immunofluorescence microscopy: To visualize tubulin distribution

Comparative transcriptome analysis has revealed significant differences in gene expression between appressoria (specialized infection structures) and hyphae in C. gloeosporioides , which may include differential expression of cytoskeletal genes like TUB1. These expression differences likely play crucial roles in the pathogen's ability to transition between growth and infection stages.

How can the TUB1 gene be used as a molecular marker for taxonomic identification within the C. gloeosporioides species complex?

The TUB1 gene serves as a valuable molecular marker for taxonomic identification within the C. gloeosporioides species complex due to its evolutionary conservation combined with species-specific variations. The C. gloeosporioides complex is known for taxonomic complexity and frequent misidentification, as noted in research showing it is not as common a pathogen on tropical fruits as often reported .

Methodology for using TUB1 as a taxonomic marker:

  • PCR amplification using genus-specific primers

  • Sequencing of amplicons

  • Sequence alignment and phylogenetic analysis

  • Comparison with reference sequences

The search results indicate significant variations in TUB genes among formae specialis of C. gloeosporioides , making them useful for assessing relationships within this group. This approach has been valuable in clarifying taxonomic relationships, as demonstrated in the case of C. kahawae and C. cigarro, which were distinguished based on molecular data combined with pathological and morphological characteristics .

What site-directed mutagenesis techniques are most effective for studying TUB1 function in C. gloeosporioides?

For studying TUB1 function in C. gloeosporioides through site-directed mutagenesis, several methodological approaches have proven effective:

  • Kunkel method: Modified from protocols described by Kunkel et al., involving single-stranded DNA templates containing uracil misincorporations

  • Oligonucleotide-directed mutagenesis: Using oligonucleotides with at least 12 bp of homology on either side of the altered nucleotides

  • Alanine-scanning mutagenesis: Systematic replacement of amino acids with alanine to identify functionally important residues, similar to approaches used for yeast tubulin studies

The detailed approach described in the search results involves:

  • Creating a single-stranded DNA template with uracil misincorporations

  • Annealing a mutagenic oligonucleotide designed with homology regions flanking the mutation site

  • In vitro synthesis of the second strand

  • Transformation into E. coli strains capable of repairing uracil misincorporations

These techniques allow researchers to create specific mutations in the TUB1 gene to study structure-function relationships, including effects on microtubule stability, potential drug resistance mechanisms, and protein-protein interactions.

How does the 3D structure of TUB1 protein relate to its function in C. gloeosporioides?

While the specific 3D structure of C. gloeosporioides TUB1 has not been experimentally determined, insights can be gained from homology modeling based on solved tubulin structures, such as the bovine tubulin structure resolved at atomic resolution . By mapping the C. gloeosporioides TUB1 sequence onto these structures, researchers can predict:

  • Functional domains: Including GTP-binding sites and regions involved in microtubule assembly

  • Protein-protein interaction sites: Surfaces that interact with other tubulins or microtubule-associated proteins

  • Drug-binding sites: Regions that interact with antifungal compounds like benzimidazoles

The search results describe how researchers have mapped tubulin mutations onto structural models, revealing functional regions such as a potential binding site for benomyl in the core of β-tubulin . Additionally, residues whose mutation causes cold sensitivity were concentrated at the lateral and longitudinal interfaces between adjacent tubulin subunits , suggesting these regions are critical for microtubule stability.

This structural approach to understanding TUB1 function can guide experimental design for site-directed mutagenesis and drug development strategies targeting the fungal cytoskeleton.

What experimental approaches are most effective for studying TUB1 protein-protein interactions in C. gloeosporioides?

For studying TUB1 protein-protein interactions in C. gloeosporioides, several sophisticated experimental approaches can be employed:

  • Yeast Two-Hybrid (Y2H) Screening:

    • Express TUB1 as bait protein fused to a DNA-binding domain

    • Screen against a C. gloeosporioides cDNA library

    • Verify positive interactions through reporter gene activation

  • Co-Immunoprecipitation (Co-IP):

    • Generate antibodies specific to C. gloeosporioides TUB1

    • Precipitate TUB1 complexes and identify interacting partners by mass spectrometry

  • Bimolecular Fluorescence Complementation (BiFC):

    • Fuse TUB1 to one half of a fluorescent protein

    • Fuse potential interacting proteins to the complementary half

    • Visualize interactions through fluorescence microscopy

Building on research from yeast models, these approaches can help identify interactions similar to those found between tubulin and microtubule-binding proteins. For example, in S. cerevisiae, residues on the exterior-facing surface of α-tubulin form a binding patch for the microtubule-binding protein Bim1p . Similar interaction sites may exist in C. gloeosporioides TUB1 for fungal-specific binding partners.

How can data on benzimidazole fungicide resistance be interpreted in relation to specific mutations in the C. gloeosporioides TUB1 gene?

Interpreting benzimidazole fungicide resistance in relation to TUB1 mutations requires a methodological approach combining molecular analysis, structural biology, and functional studies:

  • Isolation and sequencing of TUB1 genes from resistant and sensitive strains

  • Identification of specific mutations associated with resistance

  • Structural mapping of mutations onto protein models

  • Site-directed mutagenesis to introduce individual mutations into sensitive strains

  • Fungicide sensitivity testing of mutant strains (determining EC50 values)

Based on comparable studies in yeast, the search results suggest that mutations causing benomyl (a benzimidazole fungicide) resistance can be mapped to specific locations within the tubulin protein structure. For example, in S. cerevisiae, modeling revealed a potential binding site for benomyl in the core of β-tubulin . Similar approaches could identify resistance-conferring mutations in C. gloeosporioides TUB1.

Mutation TypeTypical Location in ProteinCommon Phenotype
Benomyl resistanceCore of β-tubulinGrowth in presence of fungicide
Cold sensitivityLateral/longitudinal interfacesGrowth defects at low temperatures
Synthetic lethalityNear α–β interfaceLethal in combination with other mutations

How can CRISPR/Cas9 genome editing be optimized for modifying the TUB1 gene in C. gloeosporioides?

Optimizing CRISPR/Cas9 genome editing for TUB1 modification in C. gloeosporioides requires addressing several critical aspects:

  • Vector Design and Delivery:

    • Codon-optimize Cas9 for C. gloeosporioides

    • Use strong fungal promoters for Cas9 expression

    • Design sgRNAs with high specificity to target regions of TUB1

    • Deliver constructs via Agrobacterium-mediated transformation or protoplast transformation

  • Targeting Strategy Selection:

    • Gene replacement: For functional studies, replacing TUB1 with reporter genes or mutant versions

    • Point mutations: For structure-function analyses, introducing specific amino acid changes

    • Conditional systems: For essential genes, creating temperature-sensitive alleles

  • Screening and Verification Methods:

    • PCR-based screening for initial identification of edited strains

    • Sanger sequencing for confirmation of specific mutations

    • Phenotypic assays for functional validation

    • Western blotting to verify protein expression levels

  • Efficiency Enhancement Techniques:

    • Use homology-directed repair templates with ~1kb homology arms

    • Incorporate selection markers (e.g., hygromycin resistance)

    • Optimize protoplast regeneration conditions

While not specifically mentioned in the search results for C. gloeosporioides, these strategies build on established molecular techniques for fungal genetic manipulation, adapted to the specific challenges of working with this pathogen.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.