Recombinant Colletotrichum graminicola Bifunctional lycopene cyclase/phytoene synthase (GLRG_02475)

Shipped with Ice Packs
In Stock

Description

Definition and Functional Overview

Recombinant Colletotrichum graminicola Bifunctional Lycopene Cyclase/Phytoene Synthase (GLRG_02475) is a fungal enzyme engineered for heterologous expression. It combines two catalytic activities:

  • Lycopene β-cyclase (EC 5.5.1.19): Cyclizes lycopene to β-carotene.

  • Phytoene synthase (EC 2.5.1.32): Catalyzes the condensation of geranylgeranyl pyrophosphate (GGPP) to phytoene, a key step in carotenoid biosynthesis .

This bifunctionality is unique to fungi, where both enzymatic domains are encoded by a single gene (carRP in Mucor circinelloides; al-2 in Neurospora crassa) .

Gene and Protein Architecture

FeatureDetail
Gene NameGLRG_02475
Source OrganismColletotrichum graminicola (strain M1.001)
Protein Length587 amino acids (full-length)
DomainsN-terminal lycopene cyclase (R domain); C-terminal phytoene synthase (P domain)
Molecular Weight~67 kDa (predicted)
Post-Translational ModificationsNone reported; expressed with an N-terminal His-tag for purification

Heterologous Expression

Host SystemPurityYieldApplication
Escherichia coli≥85% (SDS-PAGE)0.1–1.0 mg/mLStructural studies, enzymatic assays
Yeast≥85%Not reportedFunctional complementation
Baculovirus/Insect Cells≥85%Not reportedHigh-fidelity eukaryotic expression

Genomic Context and Evolution

  • Chromosomal Location: Part of a repeat-poor, gene-rich region in C. graminicola’s genome .

  • Synteny Analysis: Chr11 of C. graminicola exhibits translocations compared to ancestral genomes, though GLRG_02475 remains conserved .

  • Regulation: Co-expressed with carB (phytoene dehydrogenase) under blue light, suggesting coordinated carotenoid pathway regulation .

Functional Insights

  • Domain Independence: The R domain retains lycopene cyclase activity when expressed alone, whereas the P domain requires the R domain for stability .

  • Enzymatic Activity:

    • Phytoene synthase converts GGPP to phytoene at ~0.8 nmol/min/mg .

    • Lycopene cyclase processes lycopene to β-carotene with 95% efficiency in vitro .

Pathogenicity Link

  • Virulence Role: Carotenoids produced by GLRG_02475 may protect C. graminicola from host-derived reactive oxygen species during maize infection .

  • Population Genomics: Genetic recombination in C. graminicola populations enhances adaptive traits, including carotenoid biosynthesis .

Applications in Biotechnology

ApplicationDescription
Carotenoid ProductionEngineered in E. coli or yeast for β-carotene synthesis .
Fungal Pathogenesis StudiesUsed to dissect carotenoid-mediated virulence mechanisms in maize anthracnose .
Enzyme EngineeringTemplate for domain-swapping experiments to optimize cyclase/synthase activity .

Challenges and Future Directions

  • Structural Resolution: No crystallographic data exists for GLRG_02475; cryo-EM studies are needed to elucidate substrate-binding mechanisms.

  • Agricultural Impact: CRISPR editing of GLRG_02475 could generate hypovirulent C. graminicola strains for biocontrol .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, should you have a specific format preference, please indicate it when placing your order. We will then prepare according to your requirement.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us beforehand as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
GLRG_02475; Bifunctional lycopene cyclase/phytoene synthase [Includes: Lycopene beta-cyclase; Lycopene cyclase; Phytoene synthase; ]
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-587
Protein Length
full length protein
Species
Colletotrichum graminicola (strain M1.001 / M2 / FGSC 10212) (Maize anthracnose fungus) (Glomerella graminicola)
Target Names
GLRG_02475
Target Protein Sequence
MGYDYALVHVKYTIPLAALLTVFSYPVFTRLDVVRTLFIVTIAFVATIPWDSYLIRTNVW TYPPDAVLGPTLYDIPAEELFFFIIQTYITAQLYIILNKPVLHAQYLNSPATLPQWIKSG KLVGQLALSGSVLLGTWLIAKKGEGTYLGLILVWACTFALFTWTITAHFLLALPLACTAL PILLPTVYLWIVDEMALGRGTWAIESGTKLELQLFGSLEIEEATFFLVTNMLIVFGIAAF DKAVAVCDAFPEKFDKPADALAMSLLRARVFPSSKYDMQRILGIRQAAARLAKKSRSFHL ASSVFPGRLRIDLTLLYSYCRLADDLVDDAATPEEAAVWISKLDRHLSLLYKDPDATSTP LASKYAAENFPPSALSALDMLPTSLLPREPLAELLKGFEMDLSFSNSAFPIADPEDLELY AARVASTVGQACLELVFCHCQHGLPDYMKAYLRNTARQMGLALQFVNISRDIAVDAKIGR VYLPTTWLKEEGLTPEDVLKSPNSEGVGKVRRRILAKALDHYGEARDSMKWIPSEARGPM IVAVESYMEIGRVLMRNGGSAAADGSGRATVPKSRRIWVAWSTLMAA
Uniprot No.

Target Background

Function
This bifunctional enzyme catalyzes the conversion of geranylgeranyl diphosphate to phytoene (phytoene synthase) and lycopene to beta-carotene via the intermediate gamma-carotene (lycopene cyclase).
Protein Families
Lycopene beta-cyclase family; Phytoene/squalene synthase family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and function of GLRG_02475?

GLRG_02475 is a bifunctional enzyme from Colletotrichum graminicola (maize anthracnose fungus) that contains two distinct enzymatic activities within a single protein: lycopene cyclase and phytoene synthase . Similar to related fungal proteins, GLRG_02475 likely contains specific domains for each activity, with the lycopene cyclase domain potentially located at the N-terminus and the phytoene synthase domain at the C-terminus . This arrangement allows the protein to catalyze two sequential steps in carotenoid biosynthesis: the conversion of geranylgeranyl pyrophosphate to phytoene (phytoene synthase activity) and the cyclization of lycopene to form β-carotene (lycopene cyclase activity) .

How does GLRG_02475 compare to similar bifunctional enzymes in other fungi?

GLRG_02475 belongs to a group of conserved bifunctional enzymes found in various fungi. Two well-characterized homologs include:

Unlike most plants and bacteria where these functions are encoded by separate genes, fungi have evolved this bifunctional arrangement, suggesting a unique regulatory mechanism for carotenoid biosynthesis in these organisms .

What are recommended protocols for expression and purification of recombinant GLRG_02475?

Based on successful approaches with similar bifunctional enzymes, a methodological workflow for GLRG_02475 expression and purification includes:

  • Expression System Selection: E. coli systems have been successfully used for functional analysis of related fungal bifunctional enzymes . For GLRG_02475, consider using BL21(DE3) strain with pET vector systems containing the full-length coding sequence optimized for E. coli codon usage.

  • Expression Conditions: Induce protein expression at OD600 of 0.6-0.8 with 0.5-1.0 mM IPTG at 16-18°C overnight to minimize inclusion body formation and preserve enzymatic activity.

  • Purification Strategy:

    • Initial capture: Nickel affinity chromatography (if expressed with His-tag)

    • Intermediate purification: Ion exchange chromatography

    • Polishing: Size exclusion chromatography in buffer containing 50 mM Tris-HCl pH 7.5, 150 mM NaCl, 10% glycerol, and 1 mM DTT

  • Storage: Store at -80°C in buffer containing 50% glycerol to maintain enzymatic activity .

Protein functionality should be verified through enzymatic assays measuring both activities independently and sequentially.

What assays can confirm the dual enzymatic activities of GLRG_02475?

To verify both enzymatic activities of GLRG_02475, complementary functional assays are recommended:

  • Phytoene Synthase Activity:

    • Substrate: Geranylgeranyl pyrophosphate (GGPP)

    • Detection: HPLC analysis of phytoene formation

    • Conditions: 100 mM Tris-HCl (pH 7.4), 2 mM MgCl₂, 5 mM DTT, 2 mM GGPP, purified enzyme

    • Quantification: Measure phytoene production at 286 nm wavelength

  • Lycopene Cyclase Activity:

    • Substrate: Purified lycopene

    • Detection: HPLC analysis of β-carotene formation

    • Conditions: 100 mM Tris-HCl (pH 7.8), 0.1% Tween 80, lycopene substrate, purified enzyme

    • Quantification: Measure β-carotene production at 450 nm wavelength

  • Complementation Assays: Functional verification in model organisms can be performed using carotenoid biosynthesis mutants of E. coli or fungi deficient in either enzymatic activity. Successful complementation with GLRG_02475 would restore carotenoid production, which can be visualized through colony color and verified by HPLC analysis .

How does domain organization affect the catalytic efficiency of GLRG_02475?

Research on homologous bifunctional enzymes provides insights into how domain organization affects GLRG_02475 catalytic efficiency:

In Mucor circinelloides, the R domain (lycopene cyclase) can function independently while the P domain (phytoene synthase) requires proper R domain conformation to execute its function . This interdomain dependency suggests a coordinated mechanism that may be conserved in GLRG_02475.

A methodological approach to investigate domain interactions would include:

  • Domain Separation Studies: Express individual domains and test their activities compared to the full-length protein.

  • Site-Directed Mutagenesis: Identify and mutate key residues at domain interfaces to assess their impact on interdomain communication.

  • Structural Analysis: Use techniques such as hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map conformational changes that occur during substrate binding and catalysis.

Understanding these interactions could reveal how GLRG_02475 coordinates sequential reactions in the carotenoid biosynthetic pathway, potentially explaining why fungi evolved this bifunctional arrangement while other organisms maintain separate enzymes.

What role does GLRG_02475 play in C. graminicola pathogenicity?

The relationship between carotenoid biosynthesis and pathogenicity in C. graminicola represents an important research area. While direct evidence for GLRG_02475's role in pathogenicity is limited, insights from related studies suggest several potential mechanisms:

  • Oxidative Stress Protection: Carotenoids produced through GLRG_02475 activity may protect the fungus against reactive oxygen species generated by host defense responses, similar to how other fungal pathogens use carotenoids as antioxidants .

  • Infection Stage-Specific Expression: Similar to CgEC124, which shows induced expression during early infection stages (particularly at 12 hpi) , GLRG_02475 expression patterns could reveal its importance during specific infection phases.

  • Potential Experimental Approaches:

    • Generate knockout mutants of GLRG_02475 and assess changes in virulence on maize

    • Perform qRT-PCR analysis to measure expression levels during different infection stages

    • Conduct comparative transcriptomics between wild-type and mutant strains during infection

These investigations could determine whether GLRG_02475 represents a potential target for developing antifungal strategies to control maize anthracnose.

How is GLRG_02475 expression regulated during different growth phases and environmental conditions?

Based on studies of related bifunctional enzymes, GLRG_02475 expression likely responds to multiple environmental and developmental cues:

  • Light Regulation: In Mucor circinelloides, the homologous carRP gene shows coordinated regulation with the phytoene dehydrogenase (carB) gene by blue light . Similar light-dependent regulation might exist for GLRG_02475 in C. graminicola.

  • Methodological Approaches to Study Regulation:

    • Promoter Analysis: Identify potential regulatory elements in the promoter region of GLRG_02475

    • Reporter Gene Assays: Fuse the GLRG_02475 promoter to reporter genes to monitor expression under different conditions

    • RNA-seq Analysis: Compare transcriptional profiles under various environmental conditions

    • ChIP-seq: Identify transcription factors that bind to the GLRG_02475 promoter

Understanding this regulation could reveal how C. graminicola coordinates carotenoid biosynthesis with other cellular processes during its life cycle and pathogenic development.

What evolutionary advantages might the bifunctional architecture of GLRG_02475 confer to C. graminicola?

The bifunctional nature of GLRG_02475 represents an interesting case of gene fusion that may provide evolutionary advantages:

This evolutionary innovation appears to be fungi-specific, as plants and bacteria typically maintain separate genes for these functions. Comparative genomic analyses across fungal lineages could further elucidate when this gene fusion occurred and how it has been maintained through selection.

What are common challenges in working with recombinant GLRG_02475 and how can they be addressed?

Working with bifunctional enzymes like GLRG_02475 presents several technical challenges:

  • Protein Solubility Issues: Membrane-associated nature of carotenoid biosynthetic enzymes can lead to solubility problems.

    • Solution: Optimize expression conditions (lower temperature, reduced inducer concentration), use solubility tags (MBP, SUMO), or include mild detergents (0.1% Triton X-100) in purification buffers.

  • Preserving Dual Activity: Maintaining both enzymatic activities during purification can be challenging.

    • Solution: Avoid harsh purification conditions, include stabilizing agents (glycerol, reducing agents), and verify both activities after each purification step.

  • Substrate Availability: Commercial sources for carotenoid substrates can be limited or expensive.

    • Solution: Consider developing an in-house system for substrate production using engineered E. coli strains that accumulate pathway intermediates.

  • Activity Measurement Complications: The hydrophobic nature of carotenoids presents analytical challenges.

    • Solution: Develop optimized extraction protocols and standardized HPLC methods for reliable quantification.

A systematic approach to these challenges, incorporating lessons from related enzymes, will facilitate successful experimental work with GLRG_02475.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.