Recombinant Colobus guereza Melanocyte-stimulating hormone receptor (MC1R)

Shipped with Ice Packs
In Stock

Description

Functional Properties

MC1R exhibits species-specific functional divergence. Key findings include:

Basal and Agonist-Induced Activity

  • Basal cAMP production: Varies across primates due to polymorphisms in TM domains .

  • α-MSH response: Dose-dependent cAMP activation (EC₅₀ = 0.3–1.2 nM in related macaques) .

Regulatory Mechanisms

  • Desensitization: GRK6 phosphorylates C-terminal residues (T308/S316), enabling β-arrestin-mediated internalization .

  • Dimerization: Homo-dimerization via disulfide bonds (e.g., C35) enhances ER-to-membrane trafficking .

Pigmentation Studies

  • Non-synonymous MC1R mutations (e.g., p.Arg217Cys in ducks, p.Val185Met in geese) correlate with melanin variation .

  • In Sulawesi macaques, MC1R variants with reduced basal activity associate with darker coat colors .

Biomedical Relevance

  • Used to study UV-induced skin damage mechanisms via pheomelanin/eumelanin balance .

  • Functional assays assess ligand efficacy (e.g., synthetic melanocortins) .

Comparative Analysis Across Species

SpeciesMC1R FeatureFunctional Impact
Macaca nigraReduced basal cAMP activityEnhanced melanin deposition
Homo sapiensR163Q polymorphismRed hair phenotype, UV sensitivity
Colobus guerezaConserved EL3 cysteinesStable ligand binding

Future Directions

  • Characterize Colobus-specific MC1R mutations in ecological adaptation studies.

  • Develop MC1R-targeted therapeutics for melanoma or vitiligo using recombinant variants .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will fulfill your requests whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
MC1R; Melanocyte-stimulating hormone receptor; MSH-R; Melanocortin receptor 1; MC1-R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-317
Protein Length
full length protein
Species
Colobus guereza (Mantled guereza) (Eastern black-and-white colobus monkey)
Target Names
Target Protein Sequence
MPVQGSQRRLLGSLNSTPTATPKLGLAANQTGAWCLEVSIPDGLFLSLGLVSLVENVLVV AAIAKNRNLHSPMYCFICCLALSDLLVSGSNMLETAVILLLEAGALAARAAVVQQLDNVI DVITCSSMLSSLCFLGAIAVDRYISIFYALRYHSIVTLPRAQRVVAAIWVASVLFSTLFI AYYDHAAVLLCLVVFFLAMLVLMAVLYVHMLARACQHAQGIAQLHKRQRPAHQGFGLKGA ATLTILLGIFFLCWGPFFLHLTLIVLCPQHPTCSCIFKNFNLFLALIICNAIIDPLIYAF RSQELRRTLKEVLLCSW
Uniprot No.

Target Background

Function
This receptor binds to melanocyte-stimulating hormone (MSH) isoforms (alpha, beta, and gamma) and adrenocorticotropic hormone (ACTH). Its activity is mediated by G proteins, which activate adenylate cyclase. This receptor plays a crucial role in melanogenesis, the process of producing eumelanin (black/brown) and phaeomelanin (red/yellow), by regulating cAMP signaling in melanocytes.
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What expression systems are suitable for recombinant Colobus guereza MC1R?

  • E. coli expression systems:

    • Advantages: High yield, cost-effective, rapid expression

    • Limitations: May lack post-translational modifications, potential for improper folding of membrane proteins

    • Applications: Structural studies, antibody production, interaction studies with purified components

  • Mammalian expression systems (HEK293, CHO cells):

    • Recommended for functional studies requiring proper trafficking and post-translational modifications

    • More likely to produce properly folded protein in native conformation

    • Suitable for signaling pathway and receptor function studies

  • Insect cell systems (Sf9, High Five):

    • Intermediate option between prokaryotic and mammalian systems

    • Often used for G-protein coupled receptors with better functional yields

The choice should be guided by the research question, with E. coli being suitable for structural studies while mammalian systems may be preferable for functional characterization of this seven-transmembrane receptor.

What are the optimal conditions for functional studies of recombinant Colobus guereza MC1R?

For functional studies of recombinant Colobus guereza MC1R, researchers should consider several critical parameters:

Storage and Stability Conditions:

  • Store lyophilized protein at -20°C/-80°C

  • Reconstituted protein should be prepared in deionized sterile water to 0.1-1.0 mg/mL

  • Addition of 5-50% glycerol (optimally 50%) for long-term storage is recommended

  • Working aliquots may be stored at 4°C for up to one week

  • Avoid repeated freeze-thaw cycles

Buffer Composition for Functional Assays:

  • Tris/PBS-based buffer at pH 8.0 containing 6% Trehalose has been established as effective

  • For membrane protein reconstitution, consider phospholipid composition mimicking native membrane environment

Ligand Binding Studies:

  • Melanocyte-stimulating hormone and related melanocortin peptides should be tested at physiological concentrations

  • Control for non-specific binding using unrelated receptors

  • Consider temperature effects on binding kinetics (typically 4°C, room temperature, and 37°C should be compared)

When designing functional assays, researchers should incorporate appropriate positive controls (known MC1R ligands) and negative controls (buffer alone, unrelated ligands) to validate receptor functionality.

How can recombinant Colobus guereza MC1R be used in comparative evolutionary studies?

Recombinant Colobus guereza MC1R offers valuable opportunities for comparative evolutionary studies across primate lineages and other mammals:

Phylogenetic Analysis Applications:

  • Sequence comparison of MC1R across primates can reveal selection pressures on pigmentation genes

  • Functional comparison of binding affinities between species can identify adaptive changes

  • Correlation of MC1R variants with coat pattern evolution in colobine monkeys

Methodology for Evolutionary Studies:

  • Sequence alignment of MC1R genes across multiple primate species, including Colobus guereza

  • Site-directed mutagenesis to introduce specific amino acid substitutions found in other species

  • Functional characterization of wild-type and mutant proteins

  • Correlation of molecular differences with phenotypic traits

The MC1R gene has shown evolutionary significance in multiple mammalian lineages. For example, studies in Kermode's bears (Ursus americanus kermodei) demonstrated that a recessive mutation in MC1R is responsible for white coat coloration in an otherwise black bear species . Similar genetic mechanisms might underlie the striking black and white coat patterns in Colobus guereza, making comparative studies between these species particularly informative.

What are the challenges in studying MC1R signaling pathways using recombinant proteins?

Researchers face several significant challenges when studying MC1R signaling pathways using recombinant proteins:

Membrane Protein Reconstitution:

  • MC1R, as a seven-transmembrane G-protein coupled receptor, requires proper membrane integration for function

  • Recombinant expression may result in misfolded protein, particularly in prokaryotic systems

  • Detergent selection for solubilization and reconstitution critically impacts functionality

Coupling to Downstream Signaling Components:

  • In vitro systems may lack necessary G-proteins and other signaling components

  • Cell-free assays require reconstitution of the complete signaling cascade

  • Differences in G-protein coupling efficiency between species may confound comparative analyses

Experimental Approaches to Address These Challenges:

ChallengeMethodological Solution
Proper foldingExpression in mammalian cells with native chaperones
Functional validationcAMP assays to verify signaling capacity
Membrane environmentReconstitution in liposomes with defined lipid composition
Signaling cascadeCo-expression with cognate G-proteins and downstream components

Researchers should consider these limitations when interpreting results from recombinant MC1R studies and validate findings using multiple complementary approaches.

What purification methods are most effective for Colobus guereza MC1R?

Effective purification of recombinant Colobus guereza MC1R requires protocols optimized for membrane proteins while maintaining structural integrity and function:

Affinity Chromatography:

  • His-tagged MC1R protein can be purified using immobilized metal affinity chromatography (IMAC)

  • Ni-NTA or Co-NTA resins are recommended with optimized imidazole gradients

  • Gentle elution conditions (20-250 mM imidazole gradient) minimize protein denaturation

Detergent Selection Considerations:

  • Initial solubilization may require stronger detergents (e.g., DDM, LMNG)

  • Exchange to milder detergents during purification (e.g., Digitonin, GDN)

  • Nanodiscs or amphipols can provide more native-like membrane environments

Recommended Purification Workflow:

  • Cell lysis under non-denaturing conditions (sonication or gentle detergent treatment)

  • Membrane fraction isolation by ultracentrifugation

  • Solubilization with appropriate detergent

  • IMAC purification of His-tagged protein

  • Size exclusion chromatography for final polishing and buffer exchange

  • Quality control by SDS-PAGE (>90% purity expected)

Throughout the purification process, maintaining protein stability with appropriate buffers (Tris/PBS-based, pH 8.0 with 6% Trehalose) and temperature control is critical for retaining functional properties .

How can the activity of recombinant Colobus guereza MC1R be assessed?

Comprehensive assessment of recombinant Colobus guereza MC1R activity requires multiple complementary approaches:

Ligand Binding Assays:

  • Radioligand binding using [125I]-labeled α-MSH or NDP-MSH

  • FRET/BRET-based binding assays with fluorescently labeled ligands

  • Surface plasmon resonance for binding kinetics determination

Functional Signaling Assays:

  • cAMP accumulation assays (MC1R couples primarily to Gαs)

  • CREB phosphorylation as a downstream marker of pathway activation

  • Ca2+ mobilization assays as secondary readout

Cell-Based Phenotypic Assays:

  • Melanin production in melanocyte cell lines expressing recombinant MC1R

  • ERK1/2 phosphorylation as measure of MAPK pathway activation

  • Gene expression analysis of MC1R-regulated genes (e.g., MITF, TYR)

Control Experiments for Validation:

  • Competitive binding with known MC1R agonists and antagonists

  • Dose-response curves to establish EC50/IC50 values

  • Comparison with MC1R from other species with established function

These methodologies provide multiple lines of evidence for receptor functionality, allowing researchers to comprehensively characterize the signaling properties of recombinant Colobus guereza MC1R.

What controls should be included in experiments using recombinant Colobus guereza MC1R?

Robust experimental design for studies utilizing recombinant Colobus guereza MC1R requires appropriate controls at multiple levels:

Protein Quality Controls:

  • SDS-PAGE analysis to confirm >90% purity

  • Western blot with anti-His antibodies to verify tag presence and integrity

  • Circular dichroism to assess secondary structure content

  • Size exclusion chromatography to verify monodispersity

Functional Controls:

  • Positive control: Known MC1R agonist (α-MSH) to verify receptor responsiveness

  • Negative control: Unrelated peptide ligand to demonstrate specificity

  • Species comparison: Human or mouse MC1R as reference receptors

  • Mutant controls: Construct with disrupted binding site as negative control

Experimental Design Controls:

  • Vehicle control: Buffer-only treatment in all assays

  • Concentration series: Full dose-response curves rather than single concentrations

  • Time-course experiments to determine optimal assay windows

  • Technical and biological replicates (minimum triplicate measurements)

When testing across different expression systems or assay conditions, researchers should maintain consistent positive and negative controls to allow for direct comparison of results and identification of system-specific artifacts.

How can researchers address poor expression yields of recombinant Colobus guereza MC1R?

When encountering poor expression yields of recombinant Colobus guereza MC1R, researchers can implement several strategic approaches:

Expression System Optimization:

  • If using E. coli (as in commercial preparations) , consider codon optimization for E. coli preference

  • Test multiple E. coli strains (BL21(DE3), Rosetta, C41/C43 for membrane proteins)

  • Adjust induction conditions (IPTG concentration, temperature, duration)

  • For membrane proteins, consider specialized strains with enhanced membrane protein expression capacity

Vector and Construct Modifications:

  • Optimize signal peptides for improved membrane targeting

  • Test different fusion tags (MBP, GST, SUMO) which may enhance solubility

  • Create truncated constructs removing potentially problematic regions

  • Introduce stabilizing mutations based on computational predictions

Culture Condition Adjustments:

  • Lower induction temperature (16-18°C) to slow expression and improve folding

  • Add chemical chaperones (glycerol, arginine) to culture media

  • Include ligands or antagonists during expression to stabilize folded states

  • Use specialized media formulations for membrane protein expression

Extraction and Purification Adaptations:

  • Optimize detergent selection for membrane extraction

  • Implement gentle cell disruption methods

  • Include protease inhibitors throughout purification process

  • Consider on-column refolding for proteins expressed in inclusion bodies

By systematically addressing these factors, researchers can significantly improve yields of functional recombinant Colobus guereza MC1R protein for subsequent studies.

What are common pitfalls in functional assays using recombinant Colobus guereza MC1R?

Researchers working with recombinant Colobus guereza MC1R should be aware of these common technical pitfalls that may compromise experimental outcomes:

Stability and Storage Issues:

  • Repeated freeze-thaw cycles causing protein denaturation

  • Inadequate glycerol concentration for long-term storage (recommended: 50%)

  • Extended storage at 4°C beyond recommended one-week period

  • Use of inappropriate buffer conditions affecting protein stability

Technical Assay Limitations:

  • Insufficient detergent removal prior to functional assays

  • Background signal from contaminating proteins (<90% purity)

  • Interference from His-tag with ligand binding or signaling

  • Non-specific binding of hydrophobic ligands to assay components

Interpretation Challenges:

  • Confusing constitutive activity with ligand-induced signaling

  • Overlooking species-specific pharmacological differences

  • Misinterpreting artifact signals as receptor activation

  • Inadequate statistical power due to insufficient replication

Methodological Recommendations:

  • Prepare single-use aliquots to avoid freeze-thaw cycles

  • Include detergent-only controls in membrane protein assays

  • Test both N-terminal and C-terminal tagged versions to identify tag interference

  • Validate results with multiple, orthogonal assay methodologies

By anticipating these pitfalls, researchers can design more robust experiments with appropriate controls and validation strategies.

How should conflicting results in MC1R studies be interpreted?

When encountering conflicting results in MC1R studies, researchers should implement a structured approach to resolve discrepancies:

Sources of Experimental Variation:

  • Expression system differences (E. coli vs. mammalian cells)

  • Protein preparation methods (detergent selection, purification strategy)

  • Assay conditions (buffer composition, temperature, pH)

  • Detection methods (radioligand vs. fluorescence-based assays)

Resolution Strategies:

Conflict TypeRecommended Resolution Approach
Binding affinity discrepanciesCompare assay conditions; standardize methods; use multiple ligand concentrations
Signaling pathway differencesVerify receptor expression levels; assess G-protein coupling efficiency; examine cell-type specific factors
Species-specific inconsistenciesConsider evolutionary divergence; examine sequence differences in binding sites; test chimeric receptors
Literature contradictionsEvaluate methodological differences; consider publication bias; replicate key experiments with consistent protocols

Integrative Analysis Framework:

  • Replicate experiments using standardized protocols

  • Apply multiple complementary methodologies

  • Systematically vary experimental parameters to identify critical variables

  • Develop mathematical models that incorporate multiple datasets

  • Consider evolutionary context when comparing across species

The study of MC1R across species highlights how variations in methodological approach can yield seemingly contradictory results. For example, in studies of mammalian MC1R function, coat color phenotypes correlate with specific mutations, but the exact mechanism and penetrance can vary between populations and environmental conditions as seen in the Kermode bear studies .

What are promising applications of Colobus guereza MC1R in comparative genetics?

Recombinant Colobus guereza MC1R offers several promising avenues for comparative genetic research:

Evolution of Primate Pigmentation Patterns:

  • Correlation between MC1R sequence variation and the distinctive black and white coat pattern of Colobus guereza

  • Comparative analysis with other colobine monkeys with different pigmentation patterns

  • Investigation of selective pressures driving coat pattern evolution in forest-dwelling primates

Molecular Evolution Studies:

  • Identification of positively selected sites in primate MC1R evolution

  • Reconstruction of ancestral MC1R sequences to trace evolutionary trajectories

  • Determination of convergent evolution in pigmentation genes across diverse mammalian lineages

Functional Genomics Applications:

  • CRISPR-based introduction of Colobus guereza MC1R variants into model organisms

  • Creation of chimeric receptors to identify functionally important domains

  • High-throughput mutagenesis to create functional maps of receptor domains

Similar evolutionary studies examining MC1R variants in bears have revealed how specific mutations lead to adaptive phenotypes like the white coat of Kermode's bears (Ursus americanus kermodei), which may provide advantages for salmon fishing . Parallel investigations in Colobus guereza could reveal whether similar molecular mechanisms underlie their distinctive coloration patterns.

How might Colobus guereza MC1R studies inform our understanding of primate evolution?

Studies of Colobus guereza MC1R can provide significant insights into primate evolution through several research approaches:

Phylogenetic Signal Analysis:

  • MC1R sequence data can help resolve phylogenetic relationships among colobine monkeys

  • Rate of MC1R evolution compared to neutral markers can identify selective pressures

  • Dating of MC1R variants can correlate with major environmental or ecological transitions

Adaptive Significance of Coat Patterns:

  • Testing hypotheses regarding the adaptive value of black and white coloration in forest environments

  • Investigation of MC1R variants in relation to geographic distribution and habitat

  • Comparative analysis with other black and white primates to identify convergent evolution

Genotype-Phenotype Correlations:

  • Identifying specific MC1R variants associated with melanin distribution patterns

  • Quantifying the effect size of MC1R polymorphisms on pigmentation phenotypes

  • Investigating epistatic interactions with other pigmentation genes

These approaches can build upon established methodologies used in studies of other mammals, such as the investigation of MC1R variants in bears that demonstrated how a recessive mutation leads to white coat color in Kermode's bears, potentially providing adaptive advantages in their specific ecological niche .

What novel techniques might enhance our ability to study MC1R function?

Emerging technologies offer exciting opportunities to advance the study of MC1R function across species, including Colobus guereza:

Advanced Structural Biology Approaches:

  • Cryo-EM for membrane protein structure determination without crystallization

  • Hydrogen-deuterium exchange mass spectrometry for conformational dynamics

  • Molecular dynamics simulations to model receptor-ligand interactions

  • AlphaFold2 and other AI-based structure prediction tools for comparative modeling

Single-Cell and Spatial Technologies:

  • Single-cell RNA sequencing to identify cell populations expressing MC1R

  • Spatial transcriptomics to map MC1R expression in tissue contexts

  • CODEX multiplexed imaging to visualize MC1R in relation to melanocytes

  • In situ hybridization with multiplexed detection for co-expression studies

Functional Genomics Tools:

  • Base editing for precise introduction of MC1R variants

  • CRISPRa/CRISPRi for endogenous MC1R regulation

  • Massively parallel reporter assays for regulatory element identification

  • Organoid models for three-dimensional tissue context studies

Biosensor Development:

  • Genetically encoded sensors for cAMP and Ca2+ signaling

  • FRET-based conformational sensors for MC1R activation states

  • Synthetic biology approaches to rewire MC1R signaling

  • Nanobody-based probes for specific MC1R conformational states

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.