Recombinant Colwellia psychrerythraea ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order remarks, and we will fulfill your request.
Lead Time
Delivery time may vary based on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us beforehand, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. For multiple uses, aliquoting is essential. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is defined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
atpB; CPS_0056; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-261
Protein Length
full length protein
Species
Colwellia psychrerythraea (strain 34H / ATCC BAA-681) (Vibrio psychroerythus)
Target Names
atpB
Target Protein Sequence
MSSGAVLTSQEYITHHLSNLKVGEGFWAVHLDSLGWSVFLGLVFLTIFRSVAKKATSGVP GKLQCAVEMVVGFVDDSVKSTFHGKNALIAPLSLTIFVWILLMNSMDWVPVDLLPHLIHW VTGMPLGDIYMKPVPTADPNITFGLALGVFILIIYYSIKVKGVGGFMKELTTQPFGHWSL YPVNFILETVTMLARPLSLALRLFGNLYAGELIFLLIATIGVFQLPVHFLWAAFHLLVIP LQAFIFMMLTIVYLSLAHEDH
Uniprot No.

Target Background

Function
As a key component of the proton channel, ATP synthase subunit a (atpB) plays a direct role in the translocation of protons across the membrane.
Database Links
Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Colwellia psychrerythraea and why is it significant in ATP synthase research?

Colwellia psychrerythraea is a psychrophilic (cold-loving) marine bacterium that serves as a model organism for studying life in permanently cold environments. Strain 34H, isolated from Arctic sediments, has become particularly important as a representative of cold-adapted microorganisms . The significance of studying ATP synthase from this organism lies in understanding cold-adapted energy production mechanisms, as C. psychrerythraea has evolved specialized cellular machinery to function efficiently at low temperatures. The ATP synthase complex, including the atpB-encoded subunit a, represents a critical component in cellular bioenergetics that has adapted to function in extreme cold conditions .

How does ATP synthase function in the context of C. psychrerythraea's cold adaptation?

ATP synthase in C. psychrerythraea functions as part of the organism's adaptation to cold environments through several mechanisms:

  • The enzyme complex maintains functionality at low temperatures where most mesophilic enzymes would become inefficient.

  • Genomic analysis suggests specific adaptations in the ATP synthase components, including amino acid composition changes that enhance enzyme effectiveness at low temperatures .

  • The ATP synthase complex in C. psychrerythraea likely exhibits increased structural flexibility compared to mesophilic counterparts, allowing it to maintain catalytic efficiency despite reduced molecular kinetic energy in cold environments .

  • The F0 sector, which includes the atpB-encoded subunit a, maintains proton translocation ability at low temperatures, ensuring the maintenance of proton motive force even in cold conditions .

These adaptations ensure that energy production can continue efficiently in the permanently cold habitats where C. psychrerythraea thrives.

What are the recommended storage conditions for recombinant C. psychrerythraea ATP synthase subunit a?

Based on product information for recombinant C. psychrerythraea ATP synthase subunit a (atpB), the recommended storage conditions are:

Storage ConditionRecommendationDuration
Short-term storage4°CUp to one week
Regular storage-20°CSeveral months
Long-term storage-80°CExtended periods

The protein is typically supplied in a Tris-based buffer with 50% glycerol to maintain stability . Repeated freeze-thaw cycles should be avoided as they can lead to protein denaturation and loss of activity. Working aliquots should be prepared and stored at 4°C for up to one week to minimize freeze-thaw damage .

What expression systems are most effective for producing recombinant C. psychrerythraea atpB protein?

While the search results don't provide specific expression protocols for C. psychrerythraea atpB, general principles for psychrophilic protein expression can be applied:

  • Expression temperature optimization: Lower expression temperatures (15-20°C) often improve the folding and solubility of psychrophilic proteins.

  • Host selection: E. coli Arctic Express or other cold-adapted expression hosts can provide chaperones that facilitate proper folding of psychrophilic proteins.

  • Codon optimization: Adjusting the coding sequence to match the codon usage bias of the expression host can significantly improve yields.

  • Solubility tags: Fusion partners such as MBP (maltose-binding protein) or SUMO can enhance solubility of membrane proteins like atpB.

  • Detergent selection: For membrane proteins like atpB, careful selection of detergents during purification is crucial to maintain native-like structure.

The recombinant protein is typically purified with appropriate tags for detection and purification, though the specific tag type may vary depending on the experimental requirements .

How does the amino acid composition of C. psychrerythraea atpB contribute to cold adaptation compared to mesophilic counterparts?

Comparative genomic and proteomic analyses suggest that cold adaptation in C. psychrerythraea proteins, including ATP synthase components, involves specific modifications to amino acid composition rather than unique genes . These adaptations likely include:

  • Increased flexibility: Higher proportion of glycine residues and fewer proline residues may enhance structural flexibility at low temperatures.

  • Reduced hydrophobic core packing: Substitutions that reduce the hydrophobic core stability allow for increased conformational flexibility at low temperatures.

  • Surface charge modifications: Changes in surface charge distribution may prevent cold denaturation and aggregation.

  • Reduced arginine content: Lower arginine levels may reduce the strength of salt bridges that could restrict conformational mobility at low temperatures.

Three-dimensional protein homology modeling comparing C. psychrerythraea proteins with those from bacteria growing at different optimal temperatures reveals compositional changes that likely enhance enzyme effectiveness at low temperatures . For atpB specifically, these adaptations would be critical for maintaining proton channel function in the cold without compromising the structural integrity needed for proton translocation.

What is the role of ATP synthase subunit a in the proton translocation mechanism of psychrophilic bacteria?

ATP synthase subunit a (atpB) plays a crucial role in the proton translocation pathway that drives ATP synthesis in all organisms, including psychrophiles like C. psychrerythraea. Recent studies on ATP synthase electric fields suggest:

  • The subunit forms a critical part of the proton channel in the F0 sector, providing the pathway for protons to move through the membrane .

  • In psychrophilic organisms, this subunit must maintain proton conductance at low temperatures where membrane fluidity is reduced and proton mobility is decreased.

  • The potential difference between proton entry and exit points enhances the electrochemical gradient of the membrane, modifying the free energy of proton translocation .

  • The potential spike at proton entry serves as a kinetic barrier, indicating that ATP synthase actively influences proton migration rather than simply providing a passive channel .

These mechanisms contribute to the remarkably high efficiency (approximately 90%) reported for ATP synthase operation . The specific amino acid composition and arrangements in the C. psychrerythraea atpB likely facilitate these functions at low temperatures through subtle structural adaptations.

How do genomic differences between C. psychrerythraea strains affect ATP synthase structure and function?

C. psychrerythraea strains isolated from different deep-sea environments show significant genomic heterogeneity despite sharing >98.2% identical 16S rRNA genes . This genomic diversity likely extends to the ATP synthase complex:

  • Whole genome sequencing revealed that different C. psychrerythraea strains (34H, ND2E, and GAB14E) can have up to 1600 strain-specific genes .

  • These strains exhibit distinct adaptations to environmental conditions, including differences in salt tolerance and carbon source utilization profiles .

  • Strains isolated from different temperatures (ranging from 0.7°C to 13.8°C) and salinities (from 35.1 to 38.9 psu) likely developed specific adaptations in their energy-generating systems, including ATP synthase .

The specific variations in the atpB gene across these strains have not been comprehensively characterized, but strain-specific adaptations in this crucial component would likely reflect optimization for local environmental conditions. Future comparative analyses of atpB sequences and structures across these strains could reveal important insights into the molecular basis of ATP synthase adaptation to varied cold marine environments.

What experimental approaches are most effective for studying proton translocation through the F0 sector in psychrophilic ATP synthases?

Several experimental approaches can be particularly effective for studying the F0 sector and proton translocation in psychrophilic ATP synthases:

  • Reconstitution systems: Incorporating purified F0 components, including recombinant atpB, into liposomes to measure proton pumping activity at different temperatures.

  • Site-directed mutagenesis: Introducing specific mutations in the atpB gene to identify critical residues for cold-adapted proton translocation.

  • Cryo-electron microscopy: This technique is particularly valuable for cold-adapted proteins as it allows visualization of structures in their native low-temperature state.

  • H/D exchange mass spectrometry: Measuring hydrogen/deuterium exchange rates to assess dynamics and accessibility of different regions of the protein at low temperatures.

  • Molecular dynamics simulations: Computational approaches that can model the behavior of the proton channel under cold conditions and predict the effects of specific amino acid substitutions.

These methods can help elucidate how the unique structural features of C. psychrerythraea atpB contribute to efficient proton translocation at low temperatures.

How can C. psychrerythraea ATP synthase components be utilized for biotechnological applications?

The cold-adapted ATP synthase components from C. psychrerythraea have several potential biotechnological applications:

  • Bioremediation in cold environments: The metabolic capabilities of C. psychrerythraea make it relevant for bioremediation of pollutants, particularly from the petroleum industry in polar seas .

  • Cold-active enzyme development: The principles of cold adaptation observed in ATP synthase components can inform the design of other cold-active enzymes for industrial processes.

  • Biosensors for low-temperature environments: ATP synthase components could be incorporated into biosensors designed to function in cold conditions.

  • Structural templates for drug design: Understanding the specific adaptations in C. psychrerythraea ATP synthase could inform the development of antimicrobials targeting this essential enzyme complex in pathogenic bacteria.

  • Bioenergy applications: The high efficiency of proton translocation and ATP synthesis at low temperatures could inform the development of bioenergy systems designed to operate with minimal energy input.

The genome sequence of C. psychrerythraea 34H reveals capabilities important to carbon and nutrient cycling, bioremediation, and production of cold-adapted enzymes that could be exploited for various biotechnological purposes .

What are the most significant challenges in expressing and purifying functional recombinant ATP synthase subunits from psychrophilic organisms?

Researchers face several significant challenges when working with recombinant ATP synthase subunits from psychrophilic organisms like C. psychrerythraea:

  • Maintaining structural integrity: Psychrophilic proteins are often less stable at room temperature, making standard expression and purification protocols potentially damaging.

  • Membrane protein solubilization: As a membrane protein, atpB requires careful selection of detergents to maintain its native structure during extraction and purification.

  • Functional reconstitution: Assembling purified subunits into a functional F0 complex requires precise conditions that mimic the native membrane environment.

  • Activity assays at low temperatures: Standard enzymatic assays may need modification to accurately measure activity at the low temperatures where these proteins naturally function.

  • Post-translational modifications: Ensuring that recombinant proteins receive any necessary post-translational modifications that might be present in the native protein.

To address these challenges, researchers often employ cold-adapted expression systems, perform purification steps at reduced temperatures, and utilize specialized detergent screens to identify optimal solubilization conditions for membrane proteins like atpB .

How does C. psychrerythraea ATP synthase differ structurally and functionally from ATP synthases in other extremophiles?

C. psychrerythraea ATP synthase represents adaptations to cold environments, which differ from adaptations seen in other extremophiles:

Extremophile TypeATP Synthase AdaptationsFunctional Implications
Psychrophiles (C. psychrerythraea)Increased structural flexibility, modified surface chargesMaintains catalytic efficiency at low temperatures
ThermophilesEnhanced structural rigidity, increased ion pairsPrevents thermal denaturation at high temperatures
HalophilesIncreased acidic residues on protein surfaceMaintains solubility in high salt environments
AcidophilesModified c-ring structure, specialized proton channelsFunctions efficiently at low pH
AlkaliphilesAdaptations for capturing protons in alkaline environmentsMaintains proton motive force despite unfavorable pH gradient

These diverse adaptations highlight the remarkable versatility of ATP synthase as a molecular machine that has evolved to function across extreme environmental conditions. The specific adaptations in C. psychrerythraea ATP synthase components like atpB reflect optimization for cold, potentially high-pressure deep-sea environments .

What evolutionary patterns can be observed in ATP synthase subunit a across different C. psychrerythraea strains and related species?

Evolutionary analysis of ATP synthase components across different C. psychrerythraea strains and related species reveals patterns that reflect adaptation to specific environmental niches:

A comprehensive phylogenetic analysis of atpB sequences across multiple C. psychrerythraea strains and related marine bacteria could provide valuable insights into the evolutionary trajectory of this essential component in response to varying environmental pressures.

What are common pitfalls in working with recombinant C. psychrerythraea ATP synthase components and how can they be addressed?

Researchers working with recombinant C. psychrerythraea ATP synthase components frequently encounter several challenges that require specific troubleshooting approaches:

Common ProblemPotential CausesSolutions
Low expression yieldsToxicity of membrane protein, codon bias, inappropriate expression temperatureOptimize expression temperature (try 15-20°C), use specialized expression strains, consider codon optimization
Protein insolubilityImproper folding, aggregation of membrane proteinScreen different detergents, use solubility tags (MBP, SUMO), consider native-like membrane mimetics
Loss of activity during purificationProtein instability at room temperature, detergent effectsPerform purification at reduced temperatures, minimize time between steps, screen gentler detergents
Inconsistent assay resultsTemperature fluctuations, buffer incompatibilityMaintain strict temperature control during assays, optimize buffer conditions for psychrophilic proteins
Poor reconstitution efficiencyImproper lipid composition, suboptimal protein:lipid ratioScreen different lipid compositions, optimize reconstitution protocols for cold-adapted membrane proteins

Additionally, when working specifically with atpB, researchers should avoid repeated freeze-thaw cycles by preparing single-use aliquots, and consider using glycerol or other cryoprotectants in storage buffers to maintain protein stability .

How can researchers verify the functional integrity of recombinant C. psychrerythraea atpB after purification?

Verifying the functional integrity of recombinant C. psychrerythraea atpB is challenging since it is a membrane subunit that typically functions as part of the larger ATP synthase complex. Researchers can employ several approaches:

  • Structural verification:

    • Circular dichroism (CD) spectroscopy to confirm secondary structure elements

    • Limited proteolysis to assess proper folding

    • Size exclusion chromatography to verify monomeric state or appropriate oligomerization

  • Functional assays:

    • Reconstitution with other F0 components to assess complex formation

    • Proton translocation assays using pH-sensitive fluorescent dyes in reconstituted liposomes

    • ATP synthesis activity when combined with F1 components

  • Binding studies:

    • Interaction assays with known binding partners from the ATP synthase complex

    • Affinity measurements for specific inhibitors of the F0 sector

  • Temperature-dependent analyses:

    • Thermal stability assays at various temperatures to confirm cold adaptation properties

    • Activity comparisons at different temperatures to verify optimal performance at low temperatures

These approaches provide complementary information about the structural and functional integrity of the recombinant protein, helping researchers ensure that their preparations maintain the native properties of C. psychrerythraea atpB.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.