Recombinant Colwellia psychrerythraea ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Description

Overview

Recombinant Colwellia psychrerythraea ATP synthase subunit b (atpF) is a synthesized protein based on the atpF subunit found in the bacterium Colwellia psychrerythraea . Colwellia psychrerythraea is a psychrophilic (cold-loving) bacterium known for its ability to thrive in frigid environments, such as deep-sea environments . ATP synthase is a vital enzyme complex responsible for producing adenosine triphosphate (ATP), the primary energy currency of cells . Subunit b (atpF) is a component of the ATP synthase complex .

Characteristics of Colwellia psychrerythraea

Colwellia psychrerythraea is a bacterium that belongs to the Colwellia genus. It is well-adapted to cold environments . Its metabolism is unusual because it does not rely on glucose or pentose sugars . It can acquire pyruvate, acetyl coenzyme A, and oxaloacetate through the degradation of citrate, malate, and amino acids acquired externally and may use compound interconversion and oxidoreductases to generate and recycle reductive power .

Structure and Function of ATP Synthase Subunit b (atpF)

ATP synthase is a protein complex present in the membranes of mitochondria, chloroplasts, and bacteria . It utilizes a proton gradient to synthesize ATP from adenosine diphosphate (ADP) and inorganic phosphate . ATP synthase subunit b (atpF) is a component of the F0 sector of the ATP synthase complex, which is embedded in the membrane . The F0 sector acts as a channel for protons to flow across the membrane, driving the rotation of the F0 sector, which is mechanically linked to the F1 sector, where ATP synthesis occurs .

Recombinant Production

Recombinant ATP synthase subunit b (atpF) is produced using genetic engineering techniques. The gene encoding atpF from Colwellia psychrerythraea is cloned and expressed in a host organism like E. coli . The recombinant protein is then purified for use in research and industrial applications .

Applications

  • ELISA assays: Recombinant Colwellia psychrerythraea ATP synthase subunit b (atpF) can be employed in enzyme-linked immunosorbent assays (ELISA) for detecting and quantifying antibodies against Colwellia psychrerythraea .

  • Structural studies: Recombinant atpF can be used in structural biology studies to determine the three-dimensional structure of the protein and understand its interactions with other components of the ATP synthase complex .

  • Drug discovery: ATP synthase is a potential drug target for developing new antibacterial agents. Recombinant atpF can be used in drug screening assays to identify compounds that inhibit ATP synthase activity .

Research Findings

  • Low-temperature adaptation: Studies on Colwellia psychrerythraea have shown that the bacterium has adapted its metabolism to function efficiently at low temperatures. Upregulation of ATP synthase genes has been observed at different temperatures .

  • Thermodynamic modeling: Thermodynamic models have been used to study the metabolic responses of Colwellia psychrerythraea to different temperature conditions. These models predict changes in metabolic efficiency, pathway usage, and metabolite ratios .

  • Genome analysis: Genomic analysis of Colwellia psychrerythraea has revealed unique features, including an unusual metabolic platform that does not rely on glucose or pentose sugars .

Available forms of Recombinant Colwellia psychrerythraea ATP synthase subunit b (atpF)

CharacteristicDescription
SpeciesColwellia psychrerythraea (strain 34H / ATCC BAA-681) (Vibrio psychroerythrus)
Uniprot NO.Q48AW4
Tag InfoThe tag type will be determined during the production process .
Storage BufferTris-based buffer, 50% glycerol, optimized for this protein
StorageStore at -20℃, for extended storage, conserve at -20℃ or -80℃. Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week .
AA SequenceMDINMTLVGQLIAFVVFVIFCMKYVWPPIIGAIEDRQATIADGLAASDRAAKDLELAQEKATAQLKEAKVQAASIVDAAKKHEAKIVDEAAGKAQVEKERILASGHAEIETERNRAKEELRKEVAVLAIAGAEKILERSIDAAAHSDILDKLVAEL
Alternative name(s)ATP synthase F(0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, Short name= F-ATPase subunit b
Gene NamesName: atpF, Ordered Locus Names: CPS_0058
Expression Region1-156
Sequence InfofµLl length protein

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpF; CPS_0058; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-156
Protein Length
full length protein
Species
Colwellia psychrerythraea (strain 34H / ATCC BAA-681) (Vibrio psychroerythus)
Target Names
atpF
Target Protein Sequence
MDINMTLVGQLIAFVVFVIFCMKYVWPPIIGAIEDRQATIADGLAASDRAAKDLELAQEK ATAQLKEAKVQAASIVDAAKKHEAKIVDEAAGKAQVEKERILASGHAEIETERNRAKEEL RKEVAVLAIAGAEKILERSIDAAAHSDILDKLVAEL
Uniprot No.

Target Background

Function

F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: F1, the extramembranous catalytic core, and F0, the membrane proton channel. These domains are connected by a central and peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled to proton translocation via a rotary mechanism involving the central stalk subunits. This protein is a component of the F0 channel and forms part of the peripheral stalk, linking F1 to F0.

Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is Colwellia psychrerythraea and why is its ATP synthase of interest to researchers?

Colwellia psychrerythraea is a marine psychrophilic bacterium that serves as a model organism for studying life in permanently cold environments. The strain 34H (ATCC BAA-681) has been completely sequenced with a genome size of 5,373,180 bp . This organism is particularly valuable for studying cold adaptation mechanisms in cellular processes.

The ATP synthase from C. psychrerythraea is of significant research interest because it represents a cold-adapted variant of this essential enzyme complex. Studying its structure and function provides insights into how critical cellular machinery adapts to function efficiently at low temperatures. From a genomic perspective, cold adaptation in this organism involves several categories of modifications including changes to cell membrane fluidity, cryotolerance compounds, and unique strategies to overcome temperature-dependent barriers to carbon uptake . The ATP synthase complex, being central to energy production, must maintain functionality under these challenging conditions, making it an excellent subject for investigating molecular adaptations to extreme environments.

What are the structural components of ATP synthase and how is subunit b (atpF) positioned within the complex?

ATP synthase (F1F0 ATP synthase or Complex V) is composed of two primary structural domains:

  • F1 domain - The extramembraneous catalytic core responsible for ATP synthesis/hydrolysis

  • F0 domain - The membrane-embedded proton channel

These domains are connected by a central stalk and a peripheral stalk . ATP synthase subunit b (atpF) is part of the peripheral stalk structure that connects the F1 and F0 domains and helps stabilize the complex during the rotational catalysis that drives ATP synthesis.

The functional arrangement of ATP synthase involves:

  • The F1 domain containing the α3β3 hexamer where catalysis occurs

  • The F0 domain embedded in the membrane facilitating proton translocation

  • Subunits α and β forming the catalytic core in F1

  • Rotation of the central stalk against the α3β3 subunits leading to ATP synthesis/hydrolysis in three separate catalytic sites on the β subunits

In this arrangement, subunit b (atpF) provides crucial structural support that prevents unproductive rotation of the entire complex during catalysis.

What expression systems are most effective for producing recombinant C. psychrerythraea ATP synthase subunit b?

Based on established protocols for similar recombinant proteins, E. coli is the preferred expression system for C. psychrerythraea ATP synthase subunit b. The T7 promoter system found in pET vectors is particularly effective, potentially allowing the target protein to comprise up to 50% of total cell protein under optimal conditions .

When expressing psychrophilic proteins, several methodological considerations are important:

  • Temperature control: Expression at lower temperatures (15-20°C) often improves folding of psychrophilic proteins

  • Induction protocols: Gradual induction using lower IPTG concentrations (0.1-0.5 mM) can enhance soluble protein yield

  • Host strain selection: E. coli Arctic Express or BL21(DE3) strains may be particularly suitable as they are optimized for low-temperature expression

For regulated expression, systems with two-stage control are beneficial. For example, the λcI repressor/pL promoter system can be employed, where expression is controlled by temperature shifts or tryptophan addition depending on the specific vector design .

What purification strategies are recommended for recombinant C. psychrerythraea ATP synthase subunit b?

Purification of recombinant C. psychrerythraea ATP synthase subunit b typically employs affinity chromatography approaches. The protein can be expressed with affinity tags such as His-tags, which facilitate purification while minimizing disruption of protein structure. Based on similar recombinant proteins, the following protocol is recommended:

  • Use N-terminal tags (e.g., 10xHis-SUMO) or C-terminal tags (e.g., Myc-tag) for affinity-based purification

  • Maintain cold conditions (4°C) throughout purification to preserve the native conformation of this psychrophilic protein

  • Employ a Tris-based buffer system with 50% glycerol for protein stabilization

  • Include cryoprotectants in buffers to maintain protein integrity

  • Use gentle elution conditions to prevent denaturation

When dealing with membrane-associated proteins like ATP synthase components, consider incorporating mild detergents during extraction and purification steps to maintain solubility while preserving native structure.

What storage conditions maximize stability of purified recombinant C. psychrerythraea ATP synthase proteins?

Optimal storage conditions for recombinant C. psychrerythraea ATP synthase proteins are:

  • Store at -20°C for routine use, or at -80°C for extended storage periods

  • Use storage buffer containing Tris-base with 50% glycerol, optimized for protein stability

  • Aliquot the protein to avoid repeated freeze-thaw cycles, which can lead to denaturation

  • For working stocks, maintain aliquots at 4°C for up to one week

These recommendations are based on established protocols for similar recombinant proteins from psychrophilic organisms, which are often more susceptible to thermal denaturation at moderate temperatures compared to their mesophilic counterparts.

How do cold adaptations manifest in the molecular structure of C. psychrerythraea ATP synthase components?

Cold adaptation in C. psychrerythraea ATP synthase components involves multiple molecular strategies that collectively enhance enzyme function at low temperatures. Research into psychrophilic proteins reveals the following adaptations likely present in ATP synthase subunit b:

  • Reduced structural rigidity: Decreased number of proline residues, fewer ionic interactions, and fewer hydrogen bonds compared to mesophilic counterparts

  • Increased flexibility of catalytic regions: Enhanced local flexibility around functional domains to maintain catalytic efficiency at low temperatures

  • Surface charge modifications: Altered surface charge distribution to maintain solubility and prevent cold denaturation

Three-dimensional protein modeling comparing C. psychrerythraea proteins with those from bacteria representing various optimal growth temperatures suggests changes to proteome composition that enhance enzyme effectiveness at low temperatures . In ATP synthase components, these adaptations likely include:

  • Increased proportion of glycine residues providing enhanced backbone flexibility

  • Reduced hydrophobic core packing allowing greater conformational freedom

  • Substitutions of bulky hydrophobic amino acids with smaller residues in the protein core

What methodological approaches are most effective for characterizing the activity of recombinant C. psychrerythraea ATP synthase subunit b?

Characterizing the activity and properties of recombinant C. psychrerythraea ATP synthase subunit b requires specialized techniques that account for its cold-adapted nature:

  • Temperature-dependent activity assays: Compare activity profiles across temperature ranges (0-37°C) to establish thermal optima and stability

  • Structural analysis at varying temperatures:

    • Circular dichroism (CD) spectroscopy to monitor secondary structure changes

    • Differential scanning calorimetry (DSC) to determine thermal transition points

    • Fluorescence spectroscopy to assess tertiary structure dynamics

  • Reconstitution experiments: Assembly of recombinant subunit b with other ATP synthase components to assess functional integration

  • Comparative analysis: Side-by-side comparison with homologous proteins from mesophilic organisms under identical conditions

When designing these experiments, it's crucial to maintain appropriate temperature controls throughout all procedures, as traditional room temperature protocols may inadvertently denature or alter the conformation of cold-adapted proteins.

How does the ATP synthase of C. psychrerythraea contribute to its survival in permanently cold environments?

The ATP synthase of C. psychrerythraea plays a critical role in maintaining energy production under cold conditions through several specialized adaptations:

  • Energy efficiency at low temperatures: Cold-adapted ATP synthase maintains higher catalytic rates at low temperatures compared to mesophilic variants, enabling sufficient ATP production in cold environments

  • Membrane fluidity integration: The F0 domain of ATP synthase must function within the context of cold-adapted membranes, which feature modified fatty acid composition for maintained fluidity at low temperatures

  • Proton gradient utilization: Enhanced efficiency in harnessing the proton motive force under conditions where metabolic reactions and respiratory chain activity may be slowed by cold temperatures

Additionally, genomic analysis of C. psychrerythraea reveals capabilities for polyhydroxyalkanoate (PHA) production, which serves as an intracellular carbon and energy reserve . This adaptation, in conjunction with efficient ATP synthase function, helps overcome cold-imposed limitations to carbon uptake and energy production, allowing the organism to thrive in permanently cold environments.

What are the theoretical mechanisms for functional coupling between cold adaptation and energy efficiency in ATP synthase?

The theoretical mechanisms coupling cold adaptation with energy efficiency in C. psychrerythraea ATP synthase involve sophisticated structural and functional modifications:

  • Optimized conformational dynamics: Cold-adapted ATP synthase components likely feature precisely calibrated flexibility that maintains catalytic efficiency at low temperatures without compromising structural integrity

  • Modified protein-protein interactions: The interfaces between subunits may feature specialized adaptations to maintain proper assembly and rotational dynamics at low temperatures

  • Altered proton binding/release kinetics: Modifications in the F0 domain may optimize proton translocation rates under cold conditions

ParameterPsychrophilic ATP SynthaseMesophilic ATP Synthase
Thermal stabilityLower thermal stability, denaturation at moderate temperaturesHigher thermal stability, resistant to moderate temperature denaturation
Structural flexibilityHigher flexibility, especially around catalytic regionsLower flexibility, more rigid structure
Catalytic efficiency at low temperaturesHigher activity at 0-15°CSignificantly reduced activity at 0-15°C
Energy coupling efficiencyOptimized for low metabolic flux conditionsOptimized for higher metabolic flux conditions

These adaptations reflect evolutionary pressure to maintain efficient energy production under permanently cold conditions, demonstrating the remarkable capacity of life to adapt to extreme environments.

What research approaches can help elucidate the relationship between C. psychrerythraea ATP synthase structure and cold adaptation?

To advance understanding of the relationship between C. psychrerythraea ATP synthase structure and cold adaptation, researchers should consider:

  • Comparative structural biology approaches:

    • Cryo-electron microscopy of intact ATP synthase complexes from psychrophilic vs. mesophilic organisms

    • X-ray crystallography of individual subunits at various temperatures

    • NMR studies to examine dynamic properties under near-physiological conditions

  • Site-directed mutagenesis experiments:

    • Systematically modify key residues identified as potential cold-adaptation determinants

    • Create chimeric proteins with domains from psychrophilic and mesophilic homologs

    • Assess functional consequences of these modifications across temperature ranges

  • Molecular dynamics simulations:

    • Model protein dynamics at various temperatures to identify critical flexibility determinants

    • Simulate protein-water interactions that may contribute to cold adaptation

    • Examine energetics of protein-protein interactions within the ATP synthase complex

  • Systems biology integration:

    • Correlate ATP synthase adaptations with genome-wide cold adaptation strategies

    • Investigate metabolic flux under various temperature conditions

    • Examine regulation of ATP synthase expression in response to temperature shifts

Implementing these research approaches would significantly advance understanding of the molecular basis for cold adaptation in this essential energy-producing complex, with potential applications in biotechnology and synthetic biology.

What controls should be included when studying recombinant C. psychrerythraea ATP synthase subunit b?

Robust experimental design for studying recombinant C. psychrerythraea ATP synthase subunit b should include:

  • Positive controls:

    • Well-characterized ATP synthase components from model organisms (E. coli, thermophiles)

    • Previously characterized psychrophilic proteins with known cold-adaptation features

  • Negative controls:

    • Denatured protein samples to establish baseline readings

    • Buffer-only conditions to account for assay artifacts

  • Temperature controls:

    • Parallel experiments conducted across a temperature range (0-37°C)

    • Time-course stability measurements at various temperatures

  • Expression system controls:

    • Host cells containing empty vector to identify background protein expression

    • Expression of non-psychrophilic homologous proteins under identical conditions

  • Purification controls:

    • Tag-only protein constructs to assess tag influence on protein properties

    • Step-wise purification sample analysis to track protein behavior throughout the process

These controls help distinguish true cold-adaptation features from artifacts of experimental design or execution, ensuring reliable and reproducible results.

How can researchers address challenges in obtaining sufficient yield of correctly folded recombinant C. psychrerythraea ATP synthase subunit b?

Obtaining sufficient yields of correctly folded recombinant C. psychrerythraea ATP synthase subunit b presents several challenges. Here are methodological approaches to address these issues:

  • Optimized expression strategies:

    • Test multiple E. coli expression strains (BL21, Arctic Express, Rosetta)

    • Employ cold-shock promoters for expression

    • Use auto-induction media optimized for low-temperature expression

    • Consider specialized T7 promoter systems that can represent up to 50% of total cell protein in successful cases

  • Solubility enhancement approaches:

    • Co-express with molecular chaperones specific for cold-adapted protein folding

    • Test fusion partners known to enhance solubility (SUMO, MBP, Thioredoxin)

    • Optimize lysis and extraction buffers with specific additives (glycerol, compatible solutes)

  • Refolding strategies if inclusion bodies occur:

    • Develop gentle solubilization protocols using mild detergents

    • Employ step-wise dialysis with decreasing denaturant concentrations

    • Include cryoprotectants during refolding to stabilize native structure

  • Scale-up considerations:

    • Implement fed-batch cultivation to maintain slow, controlled growth

    • Maintain precise temperature control throughout cultivation

    • Monitor dissolved oxygen to prevent metabolic stress

By systematically addressing these challenges, researchers can significantly improve both yield and quality of the recombinant protein while maintaining its native cold-adapted characteristics.

How should researchers compare kinetic parameters of psychrophilic ATP synthase components with mesophilic counterparts?

When comparing kinetic parameters of psychrophilic ATP synthase components with mesophilic counterparts, researchers should employ the following methodological approach:

  • Temperature normalization:

    • Compare enzymes at their respective physiological temperatures

    • Also compare at standardized temperatures to assess relative activities

    • Plot activity versus temperature curves to identify thermal optima and activity ranges

  • Key parameters to measure:

    • kcat (catalytic rate constant)

    • Km (substrate affinity)

    • kcat/Km (catalytic efficiency)

    • Activation energy (Ea)

    • Thermodynamic parameters (ΔH, ΔS, ΔG)

  • Data interpretation framework:

    • Analyze temperature dependence using Arrhenius plots

    • Compare activation energies as indicators of temperature sensitivity

    • Evaluate entropy-enthalpy compensation effects

  • Statistical approaches:

    • Employ multiple technical and biological replicates

    • Use appropriate statistical tests for parameter comparisons

    • Develop mathematical models to describe temperature-activity relationships

This comprehensive approach enables meaningful comparisons that reveal true adaptive differences rather than artifacts of experimental conditions.

What bioinformatic approaches can identify cold-adaptation signatures in C. psychrerythraea ATP synthase sequences?

Advanced bioinformatic approaches to identify cold-adaptation signatures in C. psychrerythraea ATP synthase sequences include:

  • Comparative sequence analysis:

    • Multiple sequence alignment with homologs from organisms across temperature ranges

    • Identification of conserved psychrophilic-specific substitutions

    • Calculation of amino acid composition biases relative to mesophilic homologs

  • Structural bioinformatics:

    • Homology modeling and structural comparison

    • Analysis of predicted flexibility indices and B-factors

    • Computation of surface charge distribution and hydrophobicity patterns

  • Evolutionary analyses:

    • Phylogenetic reconstruction to trace the evolution of cold adaptation

    • Detection of positive selection signatures at specific sites

    • Ancestral sequence reconstruction to identify key adaptive changes

  • Machine learning applications:

    • Development of classifiers to distinguish cold-adapted from mesophilic proteins

    • Feature extraction to identify the most informative sequence parameters

    • Predictive modeling of thermal stability based on sequence features

How can insights from C. psychrerythraea ATP synthase research be applied to biotechnological innovations?

Research on C. psychrerythraea ATP synthase components offers several promising biotechnological applications:

  • Enzyme engineering:

    • Design of cold-active enzymes for industrial processes requiring low temperatures

    • Development of enzymes with broader temperature activity ranges

    • Creation of energy-efficient biocatalysts based on psychrophilic design principles

  • Bioenergy applications:

    • Engineering of energy-efficient ATP synthase variants for biotechnological processes

    • Development of cold-active biofuel cells with enhanced efficiency at ambient temperatures

    • Design of biomimetic energy conversion systems inspired by psychrophilic adaptations

  • Pharmaceutical and biomedical applications:

    • Design of temperature-sensitive drug delivery systems

    • Development of cryopreservation solutions based on psychrophilic adaptations

    • Cold-active enzymes for diagnostic applications

  • Synthetic biology platforms:

    • Creation of cold-adapted synthetic cellular systems for specialized applications

    • Engineering of metabolic pathways optimized for low-temperature functionality

    • Development of biosensors with enhanced function in cold environments

These applications leverage the unique properties of psychrophilic proteins to address challenges in diverse fields, demonstrating the value of basic research on extremophile adaptations.

What are the most promising future research directions for understanding C. psychrerythraea ATP synthase function?

The most promising future research directions for understanding C. psychrerythraea ATP synthase function include:

  • Integrated structural biology approaches:

    • High-resolution cryo-EM studies of intact ATP synthase complexes

    • Time-resolved structural studies to capture conformational dynamics

    • In situ structural characterization within membrane environments

  • Single-molecule biophysics:

    • Direct observation of ATP synthase rotational dynamics at low temperatures

    • Force spectroscopy to measure mechanical properties of psychrophilic components

    • Single-molecule FRET to monitor conformational changes during catalysis

  • Systems-level integration:

    • Multi-omics approaches to understand ATP synthase regulation in cold environments

    • Metabolic flux analysis to quantify energy production under various conditions

    • In vivo imaging of ATP production dynamics in psychrophilic organisms

  • Synthetic biology and directed evolution:

    • Engineering minimal ATP synthase variants with enhanced cold activity

    • Directed evolution to identify critical residues for cold adaptation

    • Creation of hybrid systems combining features from diverse extremophiles

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.