Recombinant Colwellia psychrerythraea Lipid A export ATP-binding/permease protein MsbA 1 (msbA1)

Shipped with Ice Packs
In Stock

Description

Functional Role in Lipid A Transport

MsbA1 facilitates the ATP-dependent translocation of lipid A, a key component of lipopolysaccharides (LPS), from the inner to the outer membrane leaflet . Key functional insights:

  • Substrate specificity: Binds lipid A, lipopolysaccharides, and diverse drug molecules .

  • ATPase activity: Exhibits V<sub>max</sub> values of 1.7–5.3 µmol/min/mg and K<sub>m</sub> values of 0.28–0.44 mM for ATP hydrolysis .

  • Inhibition: Competitively inhibited by AMPPNP (K<sub>i</sub>: 10–20 µM) and fully suppressed by vanadate (>100 µM) .

Research Applications

  1. Lipid trafficking studies: Reconstituted MsbA1 in proteoliposomes demonstrates ATP-dependent flipping of NBD-labeled phospholipids (e.g., NBD-PE) .

  2. Antibiotic resistance: Structural homology with multidrug resistance proteins (e.g., human MDR1) positions MsbA1 as a model for studying efflux mechanisms .

  3. Enzyme engineering: Psychrophilic adaptations make MsbA1 a candidate for developing cold-active industrial enzymes .

Key Research Findings

  • Conformational dynamics: MsbA1 undergoes large-scale structural rearrangements during ATP hydrolysis, transitioning between inward-open and outward-open states .

  • Cryoprotection role: C. psychrerythraea’s genome reveals expansions in compatible solute transporters (e.g., glycine betaine), which may synergize with MsbA1 to maintain membrane integrity in cold environments .

  • Biotechnological potential: High-yield recombinant production (>90% purity) enables structural studies via cryo-EM and X-ray crystallography .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format readily available in our inventory, we are happy to accommodate specific format requests. Please indicate your preferred format in the order notes section, and we will do our best to fulfill your requirement.
Lead Time
Delivery time may vary based on the purchasing method or location. We recommend contacting your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate this with us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing cycles are discouraged. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend a brief centrifugation of the vial prior to opening to ensure the contents are collected at the bottom. Reconstitute the protein with deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard protocol utilizes 50% glycerol, serving as a reference point for customers.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid formulations is 6 months when stored at -20°C/-80°C. For lyophilized formulations, the shelf life extends to 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Minimize freeze-thaw cycles to maintain optimal protein integrity.
Tag Info
The specific tag type will be determined during the manufacturing process.
While the tag type is typically decided during production, we are open to developing a protein with a specific tag if you have a preference. Please communicate your desired tag type to us for consideration.
Synonyms
msbA1; CPS_2125; ATP-dependent lipid A-core flippase 1; Lipid A export ATP-binding/permease protein MsbA 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-602
Protein Length
full length protein
Species
Colwellia psychrerythraea (strain 34H / ATCC BAA-681) (Vibrio psychroerythus)
Target Names
msbA1
Target Protein Sequence
MASSPKTNALSSSDSANATTWQNFKRLVSYAKPYKLGFVAAIIGMLGYAAIDVYFLSQLK PLVDEGLSGANANFMKWAPLFIIVAFTVRGIAHFIANYCLAWVGNNVVADLRQKLFEHIM SMPVAFHDQTSTGSLISKITFDTEQVLNSVSKSILTIVQQSAFIIGLLGLMFYYSWQLSL IFLLITPIIAVIVSVVSKRFRKVSKNIQGAMGEVTTAAEQTFNGHKVVLTFGGQQREFSR FAKINKHNRQQRMKMRATKSASVPIIQVIASFALAFVFYAITSDSLRDSISPGTFVSIIT YMTMLLRPLKMLTNVNSEFQQGMAACTSIFSILDHEKEKDNGDKQLERASGTLSFKHVDF SYKNTNTMTTSDKEQDTKLALNDITFDLAPGETLALVGRSGSGKSTASSLLLRFYDATRG EILIDDTNIEQFQLKDLRKQFSYVSQQVVLFNDTLANNIAYGKPEATEAEIIEAAKSAHV MEFAEHMEQGLETNIGENGALLSGGQRQRVAIARALLCDTPFLILDEATSALDTESERHI QDALQTLQQNRTSIVIAHRLSTIENADKIIVMEQGKIVEQGNHQSLLAKQGAYAQLHSFQ FE
Uniprot No.

Target Background

Function
This protein plays a crucial role in lipopolysaccharide (LPS) biosynthesis. It facilitates the translocation of lipid A-core from the inner leaflet to the outer leaflet of the inner membrane. The transmembrane domains (TMD) of the protein form a pore within the inner membrane, while the ATP-binding domain (NBD) is responsible for generating the necessary energy for this process.
Database Links
Protein Families
ABC transporter superfamily, Lipid exporter (TC 3.A.1.106) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Colwellia psychrerythraea Lipid A export ATP-binding/permease protein MsbA 1 (msbA1)?

Recombinant Colwellia psychrerythraea Lipid A export ATP-binding/permease protein MsbA 1 (msbA1) is a specialized membrane protein derived from the psychrophilic bacterium Colwellia psychrerythraea strain 34H. It functions as an ATP-dependent transporter responsible for moving Lipid A, a critical component of bacterial outer membranes, across the inner membrane. The recombinant form of this protein is typically expressed in Escherichia coli expression systems to facilitate purification and characterization for research purposes. The protein consists of 602 amino acids and contains several functional domains including ATP-binding cassettes and transmembrane regions essential for its transport activity . This protein represents an important model for understanding membrane transport mechanisms in cold-adapted organisms.

How does MsbA1 differ from MsbA2 in Colwellia psychrerythraea?

MsbA1 and MsbA2 are both lipid A transport proteins in Colwellia psychrerythraea, but they differ in several important aspects. MsbA1 is encoded by the gene CPS_2125 in the C. psychrerythraea genome , while MsbA2 is encoded by CPS_2774. The amino acid sequence of MsbA1 consists of 602 amino acids, whereas MsbA2 consists of 584 amino acids . While both proteins function as ATP-dependent lipid A-core flippases that facilitate transport across the inner membrane, they likely have evolved different regulatory mechanisms or substrate specificities that allow the bacterium to adapt to varying environmental conditions. This redundancy in lipid transport systems may provide C. psychrerythraea with greater metabolic flexibility in the constantly cold marine environments it inhabits. Comparative analysis of these two proteins can provide insights into the molecular basis of cold adaptation in membrane transport proteins.

What are the structural adaptations of MsbA1 that contribute to its function in cold environments?

MsbA1 from Colwellia psychrerythraea exhibits several structural adaptations that enhance its functionality in cold environments. While not explicitly detailed for MsbA1 in the provided information, we can infer likely adaptations based on other cold-adapted proteins from C. psychrerythraea. These adaptations likely include reduced proline content, fewer ion pairs, and lower hydrophobic residue content compared to mesophilic homologs . Such modifications typically increase protein flexibility, which is crucial for maintaining catalytic activity at low temperatures. The protein may also contain specific amino acid substitutions in key regions that reduce the rigidity of the structure while maintaining essential functional domains. Additionally, the transmembrane domains likely have adaptations that maintain membrane fluidity and proper protein folding in cold conditions. These structural features collectively contribute to MsbA1's ability to function optimally in the temperature range of -1°C to 10°C, which matches C. psychrerythraea's growth conditions .

What are the optimal conditions for expression and purification of recombinant MsbA1?

The optimal expression and purification of recombinant MsbA1 from Colwellia psychrerythraea requires careful attention to temperature control and buffer composition. Based on the psychrophilic nature of the source organism, expression in E. coli host systems should be conducted at lower temperatures (typically 15-20°C) to promote proper folding of this cold-adapted protein. Induction with IPTG at lower concentrations (0.1-0.5 mM) for extended periods (16-24 hours) often yields better results than standard protocols used for mesophilic proteins. For purification, the recombinant MsbA1 is typically produced with an N-terminal His-tag, allowing for affinity chromatography using nickel or cobalt resins . Buffers should contain stabilizing agents such as glycerol (20-50%) and maintain a pH range of 7.0-8.0 to preserve protein integrity. All purification steps should ideally be performed at 4°C or lower to prevent thermal denaturation. Following purification, the protein can be stored in Tris-based buffer with 50% glycerol at -20°C for short-term storage or -80°C for extended storage, while avoiding repeated freeze-thaw cycles .

How can researchers assess the functional activity of purified MsbA1?

Researchers can assess the functional activity of purified MsbA1 through several complementary approaches. The primary function of MsbA1 as an ATP-dependent lipid A flippase can be measured using ATPase activity assays, which quantify ATP hydrolysis rates through colorimetric phosphate detection methods. These assays should be performed at temperatures ranging from 0-10°C to reflect the psychrophilic nature of the protein. Substrate binding can be evaluated using fluorescently labeled lipid A analogs and measuring changes in fluorescence anisotropy or through isothermal titration calorimetry (ITC) conducted at reduced temperatures. Reconstitution of MsbA1 into liposomes or nanodiscs allows for transport assays using fluorescently labeled lipids to directly measure flipping activity across the membrane bilayer. Circular dichroism (CD) spectroscopy can be employed to assess proper folding and thermal stability profiles, with expected maximum denaturation temperatures significantly lower than mesophilic counterparts. Additionally, researchers should consider including extracellular polymeric substances (EPS) from C. psychrerythraea in activity assays, as these have been shown to enhance the stability and activity of other cold-adapted enzymes from this organism at environmentally relevant temperatures .

What technical challenges are associated with structural studies of MsbA1, and how can they be overcome?

Structural studies of MsbA1 present several technical challenges due to its nature as both a membrane protein and a cold-adapted enzyme. The primary obstacles include protein instability at temperatures above 10°C, difficulties in crystallization of flexible psychrophilic proteins, and the inherent challenges of membrane protein structural biology. To overcome these challenges, researchers should implement several specialized approaches. First, all purification and handling steps should be conducted at 4°C or lower, potentially using specialized cold rooms for crystallization setups. The addition of stabilizing agents such as extracellular polymeric substances (EPS) from C. psychrerythraea can significantly enhance protein stability, as demonstrated with other enzymes from this organism . For crystallography, lipidic cubic phase methods may be more successful than traditional vapor diffusion approaches. Alternatively, cryo-electron microscopy (cryo-EM) offers advantages for flexible proteins, allowing vitrification at low temperatures that preserve the native conformation. Nuclear magnetic resonance (NMR) studies can be performed at reduced temperatures (0-4°C) to examine protein dynamics. Additionally, researchers should consider combining computational approaches like molecular dynamics simulations optimized for cold temperatures with experimental data to develop comprehensive structural models of this challenging protein.

How does MsbA1 from Colwellia psychrerythraea compare to homologous proteins from mesophilic bacteria?

MsbA1 from Colwellia psychrerythraea shows significant differences when compared to homologous proteins from mesophilic bacteria, reflecting adaptations to its psychrophilic lifestyle. While specific comparison data for MsbA1 is not provided in the search results, patterns observed in other cold-adapted proteins from C. psychrerythraea suggest several key differences. Cold-adapted proteins typically exhibit greater flexibility to maintain catalytic activity at low temperatures, achieved through fewer proline residues, reduced ion pairs, and lower hydrophobic amino acid content . These modifications likely exist in MsbA1 compared to mesophilic homologs. Sequence analysis would likely reveal 45-55% identity with mesophilic counterparts from gamma Proteobacteria, similar to the pattern observed with other C. psychrerythraea enzymes . Functionally, MsbA1 would be expected to demonstrate optimal ATPase and transport activity at significantly lower temperatures (likely 0-10°C) compared to mesophilic versions (typically 30-37°C). Additionally, MsbA1 would likely show greater thermolability, with activity rapidly declining above 15-20°C, while maintaining higher relative activity at subzero temperatures where mesophilic enzymes become essentially inactive. These differences reflect evolutionary adaptation to the constant cold marine environments where C. psychrerythraea thrives.

What insights can be gained from studying MsbA1 in the context of ABC transporter evolution?

Studying MsbA1 from Colwellia psychrerythraea provides valuable insights into ABC transporter evolution, particularly regarding adaptation to extreme environments. As a psychrophilic ATP-binding cassette transporter, MsbA1 represents an evolutionary adaptation to consistently cold marine environments. Comparative genomic analysis between MsbA1, its paralog MsbA2 (CPS_2774), and mesophilic homologs can reveal how selective pressures in cold environments have shaped the sequence, structure, and function of these essential membrane transporters . Specific evolutionary adaptations likely include amino acid substitutions that increase protein flexibility while maintaining transport function, modifications to ATP-binding domains that optimize nucleotide hydrolysis at low temperatures, and alterations to transmembrane domains that ensure proper membrane integration in cold-adapted lipid bilayers. The presence of two MsbA homologs (MsbA1 and MsbA2) in C. psychrerythraea suggests gene duplication events that may have allowed functional specialization, providing redundancy for this critical cellular function in challenging environmental conditions. Additionally, studying the evolutionary relationship between these bacterial transporters and related eukaryotic proteins (like the 35-36% identity observed between other C. psychrerythraea proteins and mammalian homologs) can provide insights into the ancient origins and divergence of the ABC transporter superfamily .

How do the kinetic properties of MsbA1 differ from those of thermophilic and mesophilic ABC transporters?

The kinetic properties of MsbA1 from Colwellia psychrerythraea likely exhibit distinct differences compared to thermophilic and mesophilic ABC transporters, reflecting adaptations to function optimally at low temperatures. While specific kinetic data for MsbA1 is not provided in the search results, extrapolation from other cold-adapted enzymes from C. psychrerythraea suggests several key differences. Psychrophilic transporters like MsbA1 typically demonstrate higher catalytic efficiency (kcat/Km) at low temperatures (0-10°C) compared to mesophilic and thermophilic counterparts, achieved through reduced activation energy requirements. MsbA1 likely exhibits greater substrate affinity (lower Km values) at low temperatures, compensating for reduced molecular movement and collision frequency in cold environments. The ATPase activity of MsbA1 would be expected to show a temperature optimum around 8-10°C, significantly lower than mesophilic (30-37°C) and thermophilic (50-80°C) homologs. Additionally, MsbA1 would likely demonstrate rapid inactivation above 15-20°C due to increased structural flexibility that promotes cold activity but reduces thermal stability . This heat lability contrasts sharply with thermophilic ABC transporters, which maintain stability at high temperatures but show minimal activity in cold conditions. These kinetic adaptations reflect the evolutionary pressure on C. psychrerythraea to maintain essential membrane transport functions in permanently cold marine environments.

How does the function of MsbA1 contribute to the cold adaptation of Colwellia psychrerythraea?

The function of MsbA1 contributes significantly to the cold adaptation of Colwellia psychrerythraea through its essential role in outer membrane biogenesis under psychrophilic conditions. As an ATP-dependent lipid A-core flippase, MsbA1 ensures the proper transport of lipid A across the inner membrane, which is critical for assembling the outer membrane that serves as the primary barrier between the bacterium and its cold environment. The proper functioning of MsbA1 at low temperatures (optimal growth at 8°C with survival at temperatures as low as -10°C) enables C. psychrerythraea to maintain membrane integrity and fluidity in cold marine environments . This is particularly important because cold temperatures typically reduce membrane fluidity, which can impair cellular functions. The psychrophilic adaptations in MsbA1's structure likely include modifications that enhance protein flexibility and optimize ATP hydrolysis at low temperatures, similar to other cold-adapted enzymes from this organism . Additionally, the redundancy provided by having both MsbA1 and MsbA2 transporters may offer metabolic flexibility that helps C. psychrerythraea adapt to varying conditions within its cold habitat. The proper transport of lipid A also ensures the bacterium can produce appropriate outer membrane components essential for biofilm formation and cryoprotection, which are key survival strategies in permanently cold environments .

What is the relationship between MsbA1 activity and membrane lipid composition in cold environments?

The relationship between MsbA1 activity and membrane lipid composition in cold environments represents a critical aspect of Colwellia psychrerythraea's adaptation to psychrophilic conditions. In cold environments, bacteria typically modify their membrane lipid composition to maintain appropriate fluidity, often increasing unsaturated fatty acids and decreasing average chain length. As a lipid A transporter, MsbA1 must function efficiently with these cold-adapted lipid substrates. The activity of MsbA1 likely influences and is influenced by the unique lipid composition of C. psychrerythraea membranes, which have evolved to maintain fluidity at temperatures as low as -10°C where the organism remains motile . The protein's structure and function have co-evolved with these specialized lipids, optimizing transport efficiency under cold conditions. Additionally, C. psychrerythraea produces extracellular polymeric substances (EPS) that have been shown to enhance the stability and activity of its cold-adapted enzymes . These EPS likely interact with membrane proteins like MsbA1, potentially modulating their function in the cold. The proper export of lipid A facilitated by MsbA1 is essential for maintaining the specialized outer membrane composition that allows C. psychrerythraea to thrive in permanently cold environments and may also contribute to the organism's ability to withstand high pressure in deep-sea environments .

What potential applications exist for MsbA1 in cold-active enzyme research and biotechnology?

Recombinant MsbA1 from Colwellia psychrerythraea offers diverse applications in cold-active enzyme research and biotechnology. As a psychrophilic ATP-binding cassette transporter, MsbA1 serves as an excellent model for studying cold adaptation in membrane proteins, with potential applications in several biotechnological areas. In bioremediation, MsbA1's ability to function at low temperatures makes it valuable for developing strategies to clean up petroleum contamination in polar regions, an increasing concern as industrial activity expands in these environments . The protein could be incorporated into engineered microorganisms or enzyme cocktails designed to function in cold conditions where conventional remediation approaches fail. In pharmaceutical research, understanding MsbA1's structure and function can guide the development of novel antibiotics targeting bacterial membrane assembly, potentially addressing antibiotic resistance by exploiting new molecular targets. As a cold-adapted membrane protein, MsbA1 also has potential applications in the development of cold-active detergents for low-temperature cleaning processes, reducing energy consumption in industrial and laboratory settings. Additionally, the protein could serve as a template for protein engineering efforts aimed at creating cold-active variants of industrially important transporters, enhancing their performance in low-temperature bioprocesses such as food fermentation, biofuel production, and pharmaceutical manufacturing that benefit from reduced temperatures to improve product stability or reduce energy costs.

How can studying MsbA1 contribute to the development of novel antimicrobial strategies?

Studying MsbA1 from Colwellia psychrerythraea can significantly contribute to the development of novel antimicrobial strategies through multiple avenues of research. As a critical component of bacterial outer membrane biogenesis, MsbA1 represents a potentially valuable antimicrobial target. Specific inhibitors designed to block MsbA1 function could disrupt membrane assembly in pathogens, particularly those causing infections in cooler body regions or refrigerated food products. Structural analysis of psychrophilic MsbA1 compared to mesophilic homologs can reveal unique binding pockets or conformational states that might be exploited for selective inhibitor design. Additionally, understanding how this cold-adapted protein maintains flexibility and function at low temperatures could inform the development of antimicrobials that remain effective in cold storage conditions or when treating infections in cooler body sites. The lipid A transport pathway in which MsbA1 participates is essential and conserved across many bacterial species, making it an attractive target for broad-spectrum antimicrobial development. Furthermore, as antibiotic resistance continues to emerge as a global health challenge, targeting non-conventional bacterial systems like lipid A transport offers new strategies to overcome resistance mechanisms. Finally, comparative analysis between MsbA1 and human ABC transporters can help identify structural and functional differences that could be exploited to develop antimicrobials with minimal toxicity to human cells, addressing a key challenge in antimicrobial therapy.

What insights from MsbA1 research could be applied to the design of temperature-stable pharmaceuticals and industrial enzymes?

Research on MsbA1 from Colwellia psychrerythraea provides valuable insights applicable to the design of temperature-stable pharmaceuticals and industrial enzymes through understanding its unique cold adaptation mechanisms. The structural features that allow MsbA1 to remain flexible and functional at near-freezing temperatures—likely including reduced proline content, fewer ion pairs, and lower hydrophobic residue content—offer design principles for engineering temperature-tolerant proteins . These principles could be applied to pharmaceutical proteins such as therapeutic antibodies or enzymes, enhancing their stability during cold storage and transport, thereby reducing the need for strict cold chain management in global distribution. The study of MsbA1 also reveals the importance of environmental factors in protein stability; the finding that extracellular polymeric substances (EPS) significantly enhance enzyme stability at both low and high temperatures suggests that incorporating similar stabilizing excipients could improve pharmaceutical formulations . For industrial enzymes used in cold processes (like detergents, food processing, or bioremediation), the molecular adaptations of MsbA1 provide a blueprint for rational protein design or directed evolution approaches to create variants with enhanced cold activity while maintaining adequate thermostability. Additionally, understanding how this membrane protein maintains proper folding and function in cold environments could inform the development of membrane-associated pharmaceuticals with improved stability profiles across temperature ranges, addressing a significant challenge in drug formulation and delivery.

What are the recommended protocols for analyzing MsbA1 membrane integration and topology?

Analyzing MsbA1 membrane integration and topology requires specialized protocols adapted for psychrophilic membrane proteins. A comprehensive approach would combine complementary techniques performed at reduced temperatures appropriate for this cold-adapted protein. Researchers should begin with in silico prediction using algorithms like TMHMM, Phobius, and TOPCONS to generate initial topology models based on the protein's 602-amino acid sequence . For experimental verification, cysteine scanning mutagenesis can be employed, introducing single cysteine residues at predicted loop regions followed by accessibility testing with membrane-impermeable thiol-reactive reagents. All reactions should be performed at 4-8°C to maintain protein stability. Protease protection assays using proteases active at low temperatures can identify exposed regions in reconstituted proteoliposomes, with digestion patterns analyzed by SDS-PAGE and Western blotting using antibodies against the His-tag or specific MsbA1 epitopes . Fluorescence techniques including site-specific labeling with environment-sensitive probes can provide information about residue localization relative to the membrane. For higher-resolution analysis, hydrogen-deuterium exchange mass spectrometry performed at 4°C can map solvent-accessible regions while cryo-electron microscopy circumvents the need for crystal formation, which is particularly challenging with flexible psychrophilic proteins. Researchers should include appropriate controls with well-characterized mesophilic ABC transporters and consider performing experiments in the presence of extracellular polymeric substances from C. psychrerythraea, which have been shown to stabilize the native conformation of cold-adapted proteins from this organism .

How should researchers address stability issues when working with recombinant MsbA1?

Addressing stability issues when working with recombinant MsbA1 from Colwellia psychrerythraea requires specialized approaches that account for its psychrophilic nature and membrane protein characteristics. Researchers should implement a comprehensive stability management strategy starting with expression conditions that include reduced induction temperatures (15-20°C) and longer induction times to promote proper folding. All purification steps should be conducted at 4°C or lower, using degassed buffers containing 20-50% glycerol as a stabilizing agent . The addition of extracellular polymeric substances (EPS) from C. psychrerythraea culture medium has been demonstrated to significantly enhance the stability of other cold-adapted enzymes from this organism at both low and high temperatures, suggesting this approach would benefit MsbA1 stability as well . For membrane extraction and reconstitution, mild detergents like n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) at concentrations just above their critical micelle concentration are recommended to avoid protein denaturation. Storage should utilize small aliquots at -80°C to prevent repeated freeze-thaw cycles, with the addition of protease inhibitors to prevent degradation . For functional assays, researchers should maintain temperature control at 0-10°C, corresponding to the organism's natural growth range . Additionally, incorporating lipids extracted from C. psychrerythraea or synthetic lipids mimicking its membrane composition into reconstitution mixtures may better preserve the native conformation and activity of this cold-adapted membrane transporter.

What are the major unanswered questions regarding MsbA1 function and cold adaptation?

Several critical unanswered questions remain regarding MsbA1 function and cold adaptation that represent significant gaps in our understanding of this psychrophilic membrane transporter. First, the precise molecular mechanisms that allow MsbA1 to maintain flexibility and activity at near-freezing temperatures without compromising structural integrity remain poorly characterized. Specific amino acid substitutions and structural modifications that differentiate it from mesophilic homologs need detailed investigation. Second, the functional relationship between MsbA1 and MsbA2 in Colwellia psychrerythraea remains unclear—whether they possess different substrate specificities, are expressed under different environmental conditions, or provide functional redundancy requires elucidation . Third, the energetics of ATP hydrolysis and coupling to lipid transport at low temperatures presents a fascinating biophysical question, as cold environments typically reduce molecular movement and reaction rates. Fourth, the interaction between MsbA1 and the unique lipid composition of C. psychrerythraea membranes, which must maintain fluidity at low temperatures, remains unexplored. Fifth, the role of extracellular polymeric substances (EPS) in modulating MsbA1 activity in vivo requires investigation, as these substances have been shown to enhance stability of other cold-adapted enzymes from this organism . Finally, the evolutionary pathway through which MsbA1 acquired its cold adaptations represents an important unanswered question that could provide insights into bacterial adaptation to extreme environments. Addressing these questions would significantly advance our understanding of membrane transport processes in psychrophilic organisms.

How might new technological advances be applied to further MsbA1 research?

Emerging technological advances offer promising opportunities to advance MsbA1 research, providing unprecedented insights into this cold-adapted membrane transporter. Cryo-electron microscopy (cryo-EM) techniques, particularly advances in single-particle analysis and tomography, are ideally suited for studying MsbA1, as they allow structural determination at near-native temperatures without requiring crystallization—a significant advantage for flexible psychrophilic proteins. Time-resolved cryo-EM could potentially capture the transporter in different conformational states during the transport cycle. Advanced molecular dynamics simulations specifically parameterized for low-temperature conditions can model MsbA1 behavior in psychrophilic membranes, providing insights into cold-adapted transport mechanisms. AlphaFold2 and similar AI-based structure prediction tools could generate high-confidence models of MsbA1 that inform experimental design when integrated with sparse experimental data. Nanoscale lipid bilayers, including nanodiscs and lipid cubic phase systems, offer improved platforms for reconstituting MsbA1 in near-native environments for functional studies. Single-molecule fluorescence techniques performed at controlled low temperatures could track conformational changes during transport cycles with unprecedented precision. CRISPR-Cas9 genome editing of C. psychrerythraea would allow in vivo studies of MsbA1 function through targeted mutations, while high-sensitivity metabolomics approaches could characterize the impact of MsbA1 function on cellular lipid composition. Finally, microfluidic systems maintaining precise temperature control could facilitate high-throughput screening of conditions affecting MsbA1 stability and activity, accelerating both fundamental research and biotechnological applications of this unique cold-adapted transporter.

What collaborative research approaches would be most beneficial for advancing understanding of psychrophilic membrane transporters like MsbA1?

Advancing understanding of psychrophilic membrane transporters like MsbA1 would benefit tremendously from interdisciplinary collaborative research approaches that bridge multiple scientific domains. A comprehensive research program should integrate structural biology teams specializing in membrane protein analysis with microbial ecologists studying psychrophiles in their natural cold marine habitats. This collaboration would connect protein function to ecological relevance. Biophysicists focusing on membrane dynamics at low temperatures would provide crucial insights when partnered with biochemists characterizing enzyme kinetics of cold-adapted transporters. Computational biologists developing specialized algorithms for modeling protein dynamics at low temperatures could work alongside evolutionary biologists tracking the genetic changes that led to cold adaptation in membrane transporters. Biotechnology researchers developing cold-active enzymes for industrial applications would benefit from collaboration with pharmaceutical scientists exploring these transporters as antimicrobial targets. Establishing a centralized biobank of psychrophilic organisms and their purified proteins would facilitate standardized comparative studies across multiple laboratories. International collaboration involving research stations in polar regions would provide access to new psychrophilic species and environmental samples. Multi-institutional funding initiatives specifically targeting cold-adapted membrane transport systems could coordinate research efforts and accelerate progress. Additionally, partnerships between academic institutions and biotechnology companies would facilitate translation of fundamental discoveries into practical applications, from bioremediation of cold environments to development of novel cold-active industrial enzymes and temperature-stable pharmaceuticals .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.