Recombinant Colwellia psychrerythraea Probable intracellular septation protein A (CPS_2317)

Shipped with Ice Packs
In Stock

Description

Introduction to Colwellia psychrerythraea 34H

Colwellia psychrerythraea strain 34H is a marine psychrophilic bacterium that serves as a model organism for studying life in permanently cold environments. The complete genome sequence of this organism, consisting of 5,373,180 base pairs, has revealed numerous capabilities crucial for carbon and nutrient cycling, bioremediation, production of secondary metabolites, and cold-adapted enzymes . As a true psychrophile, C. psychrerythraea has evolved specialized mechanisms to maintain cellular functions at temperatures near or below freezing.

The genomic analysis of C. psychrerythraea suggests that cold adaptation is achieved through multiple strategies including modifications to cell membrane fluidity, uptake and synthesis of cryoprotective compounds, and mechanisms to overcome temperature-dependent barriers to carbon uptake . These adaptations are reflected in the organism's proteome composition, which likely contains modifications that enhance enzyme effectiveness at low temperatures rather than through a unique set of genes specific to psychrophiles.

Identification and Classification

The intracellular septation protein A, designated as CPS_2317 in the C. psychrerythraea genome, is classified as a probable septation protein based on sequence homology and predicted function . This protein is part of the complex cellular machinery involved in bacterial cell division, particularly in the formation of the septum during cytokinesis. The "probable" designation indicates that while its function has been computationally predicted, detailed experimental confirmation of its specific role may still be pending.

Genetic Context and Evolution

CPS_2317 is encoded within the genome of C. psychrerythraea strain 34H (ATCC BAA-681), previously known as Vibrio psychroerythus . The gene is cataloged in protein databases with the UniProt accession number Q482I0, facilitating cross-reference with other sequence repositories and functional databases . While the evolutionary history of this specific protein is not extensively documented in the available literature, it likely shares common ancestry with septation proteins from related bacterial species, possibly with adaptive modifications for function in cold environments.

Physicochemical Properties

Based on the amino acid composition and sequence analysis, the following physicochemical properties of CPS_2317 can be inferred:

PropertyCharacteristicDetails
Molecular Weight~22 kDa (estimated)Based on the 194 amino acid sequence
HydrophobicityHighMultiple hydrophobic regions suggest membrane association
Isoelectric Point~9.5 (estimated)Based on amino acid composition with basic residues
Secondary StructurePredominantly alpha-helicalConsistent with transmembrane proteins
StabilityModerate thermolabilityCharacteristic of psychrophilic proteins
Storage Requirements-20°C to -80°C50% glycerol in Tris-based buffer

The protein's characteristics align with those expected for cold-adapted proteins from psychrophilic organisms, which often exhibit increased structural flexibility and reduced thermal stability compared to mesophilic counterparts.

Cell Division and Septation

As its name suggests, the probable intracellular septation protein A (CPS_2317) likely plays a role in bacterial cell division, specifically in the formation of the septum that divides the cytoplasm during binary fission . Septation proteins are crucial for proper cellular division and ensuring the integrity of daughter cells after separation. In psychrophilic bacteria like C. psychrerythraea, these processes must function efficiently at low temperatures, suggesting potential cold-adapted features in this protein.

Membrane Association and Cold Adaptation

The amino acid sequence of CPS_2317 indicates a high proportion of hydrophobic residues arranged in patterns consistent with transmembrane domains . This suggests the protein is membrane-associated, potentially inserting into or spanning the cytoplasmic membrane. This membrane association is particularly significant in the context of C. psychrerythraea's psychrophilic lifestyle, as membrane fluidity and function at low temperatures represent major challenges for cold-adapted organisms.

While not specifically addressing CPS_2317, genome analyses of C. psychrerythraea have revealed numerous adaptations related to membrane function in cold environments, including genes for polyunsaturated fatty acid synthesis, fatty acid cis/trans isomerases, and expanded gene families related to fatty acid metabolism . These adaptations collectively enhance membrane fluidity at low temperatures, a critical requirement for psychrophilic bacteria. As a membrane-associated protein involved in cell division, CPS_2317 likely functions within this specialized membrane environment.

Recombinant Protein Production

The recombinant form of CPS_2317 is commercially available for research purposes. These commercial preparations typically provide the protein in a purified form suitable for various biochemical and structural studies . The standard quantity offered is 50 μg, with additional quantities available upon request. The recombinant protein is supplied in a Tris-based buffer containing 50% glycerol, optimized for protein stability .

Research Applications

The recombinant CPS_2317 protein can be utilized in various research applications, particularly in studies focusing on:

  1. Psychrophilic adaptation mechanisms in bacterial proteins

  2. Bacterial cell division processes in cold environments

  3. Comparative studies of septation proteins across temperature ranges

  4. Structure-function relationships in cold-adapted membrane proteins

  5. Development of novel enzyme applications derived from psychrophiles

Enzyme-linked immunosorbent assay (ELISA) applications are specifically mentioned for this recombinant protein, suggesting its use in immunological detection and quantification methods .

Cold Adaptation Strategies in Proteins

While specific comparative studies involving CPS_2317 are not documented in the available research results, insights can be drawn from studies of other cold-adapted proteins from C. psychrerythraea. For example, research on the cold-shock protein from C. psychrerythraea (Cp-Csp) has revealed structural features that contribute to psychrophilic adaptation .

Cp-Csp exhibits lower thermostability (37°C) compared to its mesophilic and thermophilic counterparts, attributed to several structural features: a flexible protein backbone, fewer salt bridges, longer flexible loops, and a less compact hydrophobic core . Similar adaptations might be present in CPS_2317, potentially contributing to its function at low temperatures.

Functional Validation Studies

Experimental validation of CPS_2317's role in septation and cell division represents another important research direction. Gene knockout or knockdown studies, coupled with phenotypic analysis, could confirm the protein's function and assess its essentiality in C. psychrerythraea. Additionally, localization studies using fluorescently tagged versions of the protein could verify its subcellular distribution during various growth phases and under different temperature conditions.

Biotechnological Applications

The unique properties of psychrophilic proteins, including potential activity at low temperatures and structural flexibility, make them valuable for biotechnological applications. CPS_2317, if its septation function is confirmed, could offer insights into bacterial cell division under extreme conditions. Additionally, any unique structural features identified could inform the design of protein engineering strategies for enhancing low-temperature activity in industrial enzymes.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributor for specific delivery details.
Note: All proteins are shipped with standard blue ice packs. For dry ice shipping, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
yciB; CPS_2317; Inner membrane-spanning protein YciB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-194
Protein Length
full length protein
Species
Colwellia psychrerythraea (strain 34H / ATCC BAA-681) (Vibrio psychroerythus)
Target Names
CPS_2317
Target Protein Sequence
MQLFIEYFPLLIFFIINSIAGIYWATGSLIVAAFVQIFYYKIKKEKIPAKQWIIFGLIVV FGGLTIYLQNDAFLKWKVTIINAFFAAALLVSNTFFNKNIIKEFLAESLSLPENIWSRLN LAWALFFLFCSGLNYYIAFNYDLDTWVNFKVFGLTGLMFLFSITSILFLYKYLEVEEEIN DTDTINNEKTKEST
Uniprot No.

Target Background

Function
This protein plays a crucial role in cell envelope biogenesis, maintaining cell envelope integrity and membrane homeostasis.
Database Links
Protein Families
YciB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How does the psychrophilic nature of Colwellia psychrerythraea influence the structure and function of CPS_2317?

The psychrophilic nature of Colwellia psychrerythraea, which grows optimally at low temperatures (strain 34H/ATCC BAA-681 was isolated from Arctic marine sediments), likely influences CPS_2317's structure through several cold-adaptation mechanisms. Psychrophilic proteins typically feature increased flexibility, reduced hydrophobic core packing, and modified surface charge distributions that maintain functionality at low temperatures. For CPS_2317, this adaptation may manifest as increased flexibility in loop regions connecting membrane-spanning domains, allowing proper septation function in cold environments where membrane fluidity is reduced. Researchers should note that while the protein's primary sequence is known, detailed structural studies specific to cold-adapted septation proteins remain limited. Temperature-dependent activity assays comparing CPS_2317 to mesophilic homologs would provide valuable insights into its cold-adaptation mechanisms .

What is the current experimental evidence for the predicted function of CPS_2317 as an intracellular septation protein?

The designation of CPS_2317 as a "Probable intracellular septation protein A" is primarily based on sequence homology and bioinformatic predictions rather than direct experimental validation. Current evidence supporting this functional annotation comes from:

  • Sequence similarity to known septation proteins in other bacterial species

  • The presence of predicted transmembrane domains consistent with septation function

  • Genomic context analysis within the Colwellia psychrerythraea genome

What are the optimal expression systems for recombinant production of CPS_2317?

The optimal expression system for CPS_2317 depends on research objectives, but several considerations apply specifically to this psychrophilic membrane protein:

  • E. coli-based expression: Often the first choice due to simplicity, but requires careful optimization for membrane proteins. Consider using C41(DE3) or C43(DE3) strains specifically designed for membrane protein expression. For CPS_2317, lower induction temperatures (15-18°C) may improve folding by mimicking the psychrophilic nature of the source organism.

  • Psychrophilic expression hosts: For native-like folding, consider psychrophilic expression systems like Pseudoalteromonas haloplanktis TAC125, which can express proteins at temperatures as low as 4°C.

  • Cell-free expression systems: These can be advantageous for membrane proteins like CPS_2317, allowing direct incorporation into nanodiscs or liposomes.

A comparative study using multiple expression systems is recommended to determine which yields properly folded, functional protein. When designing expression constructs, researchers should carefully consider fusion tags that facilitate both purification and potential crystallization trials .

What purification strategies address the challenges of working with membrane-associated proteins like CPS_2317?

Purifying membrane-associated proteins like CPS_2317 requires specialized approaches to maintain native structure and function:

Table 1: Comparison of Purification Strategies for CPS_2317

StrategyAdvantagesDisadvantagesRecommended Detergents
Detergent-based extractionMost established methodMay destabilize proteinDDM, LDAO, FC-12
Nanodisc incorporationMaintains native lipid environmentComplex preparationMSP1D1, MSP1E3D1
SMALPs (Styrene Maleic Acid Lipid Particles)Preserves native lipid interactionsLimited compatibility with some downstream applicationsSMA 2:1, SMA 3:1
Amphipol stabilizationEnhanced stability for structural studiesRequires initial detergent solubilizationA8-35, PMAL-C8

For CPS_2317 specifically, researchers should screen multiple detergents at concentrations above their critical micelle concentration (CMC) during initial extraction. The psychrophilic origin of this protein suggests that maintaining colder temperatures (4-10°C) throughout purification may improve stability. Additionally, including a mixture of lipids resembling the Colwellia membrane composition during purification can help maintain the protein's native conformation .

How can researchers verify the proper folding and activity of recombinant CPS_2317?

Verifying proper folding and activity of recombinant CPS_2317 is challenging due to limited knowledge of its precise function. Researchers should employ multiple complementary approaches:

  • Biophysical characterization:

    • Circular dichroism (CD) spectroscopy to assess secondary structure content

    • Tryptophan fluorescence spectroscopy to monitor tertiary structure

    • Size exclusion chromatography with multi-angle light scattering (SEC-MALS) to verify monodispersity and oligomeric state

  • Functional assays:

    • Liposome binding or integration assays

    • GTPase activity measurements (if CPS_2317 possesses such activity)

    • In vitro septation assays using purified division components

  • Cell-based validation:

    • Complementation studies in bacterial strains with septation defects

    • Fluorescence microscopy with labeled CPS_2317 to confirm localization to division sites

When designing activity assays, researchers should consider temperature-dependent effects, given the psychrophilic nature of Colwellia. Comparing activity profiles at different temperatures (4°C, 15°C, 37°C) can provide insights into cold-adaptation mechanisms of this septation protein .

How does CPS_2317 contribute to cell division mechanisms in psychrophilic bacteria?

Current understanding suggests CPS_2317, as a probable intracellular septation protein, likely plays a role in the cell division process of Colwellia psychrerythraea, though specific mechanisms remain to be fully characterized. Based on homology to better-studied septation proteins, CPS_2317 may:

  • Participate in Z-ring formation or stabilization during early septation stages

  • Facilitate recruitment of peptidoglycan synthesis machinery to the division site

  • Coordinate membrane invagination with cell wall synthesis during division

The psychrophilic nature of Colwellia adds complexity to this process, as cell division must occur at low temperatures where membrane fluidity is reduced. CPS_2317 may possess cold-adapted features that facilitate membrane remodeling under these conditions. Comparative studies with septation proteins from mesophilic organisms would help elucidate these adaptations.

A proposed experimental approach would be fluorescent tagging of CPS_2317 combined with time-lapse microscopy at various temperatures to track its localization during the cell cycle, complemented by interaction studies with other division proteins to map its position in the septation protein network .

What protein-protein interactions are predicted or confirmed for CPS_2317?

While specific protein-protein interactions for CPS_2317 have not been definitively characterized in the available literature, septation proteins typically form complex interaction networks. Based on studies of homologous proteins in other bacterial systems, CPS_2317 likely interacts with:

Table 2: Predicted Interaction Partners for CPS_2317

Potential PartnerPredicted Interaction TypeFunction in Cell DivisionDetection Method
FtsZDirect or indirect bindingFormation of Z-ringCo-IP, FRET, B2H
FtsARecruitment/stabilizationZ-ring anchoring to membraneCo-IP, PLA
ZipACooperative bindingZ-ring stabilizationCo-IP, FRET
FtsQ/FtsB/FtsL complexSequential recruitmentLate divisome assemblyBN-PAGE, Co-IP
PBPs (Penicillin-Binding Proteins)Functional coordinationPeptidoglycan synthesisCrosslinking, FRET

To experimentally verify these predictions, researchers should consider employing bacterial two-hybrid systems, co-immunoprecipitation studies, or fluorescence resonance energy transfer (FRET) approaches. A systematic interactome analysis using affinity purification followed by mass spectrometry would provide comprehensive insights into CPS_2317's interaction network in Colwellia psychrerythraea .

How does temperature affect the structure-function relationship of CPS_2317?

As a protein from a psychrophilic organism adapted to cold environments, temperature likely has profound effects on CPS_2317's structure-function relationship. While specific experimental data on CPS_2317's temperature-dependent behavior is limited, research on psychrophilic proteins suggests several likely characteristics:

  • Structural flexibility: CPS_2317 likely possesses increased conformational flexibility compared to mesophilic homologs, allowing it to maintain catalytic efficiency at low temperatures. This may be achieved through:

    • Reduced number of proline residues in loops

    • Fewer hydrogen bonds and salt bridges

    • Decreased hydrophobicity in the protein core

  • Activity profile: The protein likely shows an activity optimum at lower temperatures (0-15°C) with potential decreased stability at higher temperatures. Researchers should expect:

    • Higher catalytic efficiency (kcat/Km) at low temperatures compared to mesophilic homologs

    • Potential thermal denaturation at moderate temperatures (>25°C)

    • Different conformational dynamics across temperature ranges

  • Membrane interaction: As a putative membrane protein involved in septation, CPS_2317's interaction with the cell membrane is likely optimized for the increased membrane rigidity encountered at low temperatures.

Experimental approaches to investigate these relationships should include differential scanning calorimetry (DSC) to determine thermal stability, activity assays across a temperature gradient, and hydrogen-deuterium exchange mass spectrometry (HDX-MS) to probe temperature-dependent conformational dynamics .

How conserved is CPS_2317 across different Colwellia species and other psychrophilic bacteria?

Sequence conservation analysis of CPS_2317 across Colwellia species and related psychrophilic bacteria reveals important evolutionary patterns. While comprehensive data specific to CPS_2317 is limited in the provided search results, similar analyses of psychrophilic proteins suggest:

Table 3: Predicted Conservation Patterns for CPS_2317

Taxonomic GroupExpected Conservation LevelKey Conserved FeaturesDivergent Regions
Within Colwellia genusHigh (>80% identity)Transmembrane domains, functional motifsSurface-exposed loops
Across psychrophilic GammaproteobacteriaModerate (40-60% identity)Core structural elementsTerminal regions, connecting loops
Between psychrophilic and mesophilic bacteriaLow-moderate (25-40% identity)Catalytic residues, key structural featuresRegions conferring cold adaptation

Researchers investigating CPS_2317 conservation should perform detailed phylogenetic analyses that include:

  • Multiple sequence alignments with homologs from diverse bacterial species

  • Identification of cold-adaptation signatures (charged vs. hydrophobic residue distribution)

  • Mapping of conservation patterns onto predicted structural models

This evolutionary context helps identify functionally critical residues (highly conserved) versus those potentially involved in cold adaptation (divergent between psychrophilic and mesophilic organisms) .

What structural and functional differences exist between CPS_2317 and its mesophilic homologs?

Comparing CPS_2317 with its mesophilic homologs reveals adaptations that likely enable function at low temperatures, though specific experimental comparisons are not detailed in the provided search results. Based on established patterns in psychrophilic proteins, the following differences are likely:

To experimentally characterize these differences, researchers should consider comparative approaches including thermal denaturation studies, kinetic measurements across temperature ranges, and structural analyses of CPS_2317 alongside mesophilic homologs. Computational approaches like molecular dynamics simulations at different temperatures could provide additional insights into the molecular basis of cold adaptation .

How does CPS_2317 contribute to Colwellia psychrerythraea's adaptation to extreme environmental conditions?

Colwellia psychrerythraea is renowned for its adaptation to cold marine environments, and proteins like CPS_2317 likely play crucial roles in this ecological success. While specific contributions of CPS_2317 to environmental adaptation are not directly addressed in the search results, its role as a septation protein suggests several potential contributions:

  • Cold-adapted cell division: CPS_2317 likely enables efficient cell division at low temperatures where conventional septation machinery might function poorly. This adaptation would be critical for maintaining population growth in cold environments.

  • Membrane fluidity modulation: As a membrane-associated protein, CPS_2317 may help coordinate cell division with the altered membrane properties (reduced fluidity) encountered at low temperatures.

  • Pressure adaptation: Deep-sea environments where Colwellia species are found combine low temperatures with high hydrostatic pressures. CPS_2317's structure may incorporate adaptations that maintain function under these combined stressors.

  • Response to environmental fluctuations: Research on Colwellia metapangenomes suggests specific responses to environmental changes such as oil exposure. CPS_2317 may participate in cellular restructuring during stress responses, as septation proteins can be involved in stress-induced morphological changes .

To investigate these potential contributions, researchers should consider gene expression studies under varied environmental conditions, phenotypic analysis of CPS_2317 knockout mutants in stress response experiments, and comparative studies with septation proteins from non-psychrophilic organisms.

What are the challenges in crystallizing membrane proteins like CPS_2317 for structural studies?

Crystallizing membrane proteins such as CPS_2317 presents significant challenges, explaining the limited structural data available for many membrane-associated septation proteins. Researchers should be aware of these specific challenges:

  • Extraction and stability issues:

    • Maintaining protein stability outside the native membrane environment

    • Finding detergents that preserve native conformation without hindering crystal contacts

    • Dealing with conformational heterogeneity inherent to flexible membrane proteins

  • Crystallization barriers:

    • Limited hydrophilic surface area for forming crystal contacts

    • Detergent micelles obscuring potential interaction surfaces

    • Phase separation issues during crystallization trials

  • Cold-adaptation complications:

    • Increased flexibility of psychrophilic proteins reducing crystallization propensity

    • Temperature-dependent conformational changes affecting reproducibility

Researchers approaching structural studies of CPS_2317 should consider these alternative strategies:

Table 4: Structural Determination Approaches for CPS_2317

ApproachAdvantagesChallengesRecommended Modifications
Lipidic cubic phase crystallizationBetter environment for membrane proteinsTechnical complexityScreening multiple lipid compositions
Fusion protein approachIncreases hydrophilic surface areaMay affect native structureTry multiple fusion partners (T4L, BRIL)
Cryo-electron microscopyNo crystallization requiredSize limitationsConsider antibody fragments to increase particle size
NMR spectroscopySolution-state structural informationSize limitationsFocus on specific domains or fragments
Computational modelingNo experimental crystals neededAccuracy limitationsValidate with experimental constraints

For CPS_2317 specifically, researchers might consider stabilizing the protein through targeted mutagenesis of flexible regions or generating antibody fragments that recognize and rigidify the native conformation .

How can researchers effectively design experiments to elucidate the specific role of CPS_2317 in septation?

Designing experiments to determine CPS_2317's precise role in septation requires multifaceted approaches that address both localization and function:

  • Genetic approaches:

    • Generate conditional knockout strains to avoid lethality issues

    • Create point mutations in predicted functional domains

    • Construct chimeric proteins with homologs from mesophilic bacteria to identify cold-adaptation regions

  • Localization studies:

    • Fluorescent protein tagging (considering N vs C-terminal fusions)

    • Immunolocalization with domain-specific antibodies

    • Super-resolution microscopy to precisely map position within the divisome

  • Interaction mapping:

    • Bacterial two-hybrid screening against divisome components

    • Co-immunoprecipitation with crosslinking to capture transient interactions

    • Proximity labeling approaches (BioID, APEX) to identify neighboring proteins

  • Functional assays:

    • Liposome deformation assays to test membrane remodeling capabilities

    • In vitro reconstitution of minimal septation machinery

    • Temperature-dependent activity measurements

A particularly effective experimental design would combine conditional expression systems with live-cell imaging to monitor divisome assembly and constriction kinetics under varying conditions. Temperature-shift experiments would be especially valuable for understanding how CPS_2317 contributes to cold-adapted cell division .

What are the current methodological limitations in studying cold-adapted membrane proteins, and how might they be overcome?

Studying cold-adapted membrane proteins like CPS_2317 presents unique methodological challenges beyond those associated with standard membrane proteins:

  • Expression challenges:

    • Poor expression in mesophilic hosts due to misfolding or toxicity

    • Limited availability of cold-adapted expression systems

    • Difficulty maintaining low temperatures throughout purification workflows

  • Stability issues:

    • Inherent instability of psychrophilic proteins at room temperature

    • Potential denaturation during standard purification procedures

    • Challenges in distinguishing thermal unfolding from detergent-induced effects

  • Functional assessment limitations:

    • Difficulty replicating native low-temperature membrane environments

    • Limited information on natural binding partners

    • Challenges in designing temperature-appropriate activity assays

Innovative approaches to overcome these limitations include:

  • Cold-adapted expression systems: Developing optimized psychrophilic expression hosts specifically for cold-adapted membrane proteins

  • Temperature-controlled workflows: Designing specialized equipment for maintaining consistent low temperatures throughout purification

  • Native nanodiscs: Incorporating native lipids from psychrophilic bacteria into nanodiscs for stabilizing membrane proteins

  • In silico screening: Using molecular dynamics simulations to identify stabilizing mutations or optimal detergent/lipid compositions

  • Microfluidic approaches: Developing microfluidic devices that allow rapid screening of stabilization conditions while minimizing sample consumption

For CPS_2317 specifically, researchers might consider cell-free expression systems operated at low temperatures (4-10°C) with immediate incorporation into nanodiscs containing lipids extracted from Colwellia membranes. This approach would minimize exposure to potentially destabilizing conditions .

How might insights from CPS_2317 inform development of new antimicrobial strategies?

Understanding the structure-function relationship of CPS_2317 could offer valuable insights for novel antimicrobial development strategies, particularly for cold-environment pathogens:

  • Target uniqueness: If structural or functional features of CPS_2317 are conserved across psychrophilic bacteria but distinct from mesophilic homologs, these differences could be exploited for selective targeting of cold-adapted pathogens.

  • Cold-specific vulnerability: The protein may reveal cold-specific adaptations in bacterial cell division machinery that create exploitable vulnerabilities not present in mesophilic systems.

  • Biofilm disruption: Many psychrophilic bacteria form biofilms in cold environments. If CPS_2317 plays a role in cell division within biofilms, targeting it could disrupt community formation in industrial or medical settings.

  • Combination approaches: Understanding CPS_2317's interaction network might reveal synergistic targeting opportunities—combinations of compounds that simultaneously disrupt multiple components of the cold-adapted divisome.

While direct therapeutic applications would require substantial additional research, fundamental insights into cold-adapted septation mechanisms could ultimately inform design of antimicrobials effective in refrigerated environments or against psychrophilic pathogens in medical settings .

What can CPS_2317 reveal about the evolution of cell division machinery in extremophiles?

CPS_2317 represents a valuable case study in the evolution of essential cellular machinery under extreme conditions. By comparing its sequence, structure, and function with homologs across diverse bacteria, researchers can address fundamental questions about evolutionary adaptation:

  • Convergent vs. divergent evolution: Analysis of CPS_2317 alongside homologs from other extremophiles (thermophiles, halophiles, etc.) can reveal whether similar adaptive strategies evolved independently in different extreme environments or diverged from common ancestral mechanisms.

  • Evolutionary constraints: The degree of conservation in functional domains versus variable regions can illuminate which aspects of septation proteins face strict evolutionary constraints versus those with greater adaptive flexibility.

  • Horizontal gene transfer contributions: Comparative genomic analysis could reveal whether cold-adapted septation proteins like CPS_2317 evolved gradually within psychrophilic lineages or were acquired through horizontal gene transfer events.

  • Minimal functional requirements: Identifying the core conserved elements across diverse homologs helps define the minimal functional requirements for septation proteins, informing both evolutionary models and synthetic biology applications.

This evolutionary perspective not only advances our understanding of bacterial adaptation but could inform synthetic biology efforts to engineer microorganisms with expanded environmental tolerances .

What are promising future research directions for understanding CPS_2317's role in psychrophilic adaptation?

Future research on CPS_2317 should address several key knowledge gaps while leveraging emerging technologies:

  • High-resolution structural studies:

    • Cryo-EM analysis of CPS_2317 in membrane environments

    • Temperature-dependent structural dynamics using HDX-MS

    • Computational modeling validated by experimental constraints

  • Systems-level investigations:

    • Transcriptomic analysis of CPS_2317 expression under varied conditions

    • Interaction network mapping using proximity labeling approaches

    • Metagenomic analysis of homolog distribution in diverse cold environments

  • Functional characterization:

    • Development of in vitro reconstitution systems for cold-adapted divisomes

    • CRISPR-based genetic manipulation of Colwellia to study phenotypic effects

    • Single-molecule biophysical approaches to characterize membrane interactions

  • Applied research directions:

    • Exploration of biotechnological applications leveraging cold-adapted properties

    • Investigation of potential as a target for controlling psychrophilic biofilms

    • Development of expression tags based on cold-stability elements

Collaborations between structural biologists, microbiologists, and computational scientists would be particularly valuable for advancing understanding of this protein. Additionally, development of improved genetic tools for manipulating psychrophilic bacteria would significantly accelerate research progress in this field .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.