Recombinant Colwellia psychrerythraea UPF0059 membrane protein CPS_3146 (CPS_3146)

Shipped with Ice Packs
In Stock

Description

Membrane Protein Expression Systems for Colwellia psychrerythraea

The recombinant production of Colwellia membrane proteins typically employs E. coli expression systems. For example:

  • CPS_0609 (UPF0761 membrane protein) was expressed in E. coli as a full-length His-tagged protein (1–303 aa) with >90% purity .

  • Key parameters include:

    • Expression Vector: pET-based plasmids.

    • Purification: Immobilized metal affinity chromatography (IMAC) under denaturing conditions.

    • Storage: Lyophilized in Tris/PBS buffer with 6% trehalose (pH 8.0) .

ParameterCPS_0609 Specification
HostE. coli BL21(DE3)
TagN-terminal His-tag
Molecular Weight~34 kDa
Purity>90% (SDS-PAGE)
Reconstitution0.1–1.0 mg/mL in sterile water
Stability-80°C long-term; avoid freeze-thaw cycles

Challenges in Recombinant Membrane Protein Production

Key hurdles for proteins like CPS_3146 would mirror those observed in other Colwellia homologs:

  • Solubility: Hydrophobic regions necessitate detergent use or advanced solubilization strategies (e.g., de novo WRAP proteins) .

  • Stability: Psychrophilic proteins often require low-temperature handling to prevent denaturation .

  • Yield Optimization: Codon optimization, chaperone co-expression, and protease-deficient strains improve yields .

Potential Applications of Colwellia Membrane Proteins

While CPS_3146 remains uncharacterized, related proteins have applications in:

  • Bioremediation: Hydrocarbon degradation in cold environments .

  • Biotechnology: Cold-adapted enzymes for industrial processes .

  • Structural Biology: Cryo-EM studies of membrane protein complexes .

Recommended Research Directions for CPS_3146

  1. Gene Identification: Verify CPS_3146’s presence in Colwellia psychrerythraea 34H’s genome (GenBank: NC_003911) .

  2. Heterologous Expression: Test E. coli, P. pastoris, or baculovirus systems .

  3. Functional Assays: Screen for ligand binding, transport activity, or structural motifs (e.g., Pfam UPF0059 domain).

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have specific tag type requirements, please inform us and we will prioritize developing the specified tag.
Synonyms
mntP; CPS_3146; Putative manganese efflux pump MntP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-181
Protein Length
full length protein
Species
Colwellia psychrerythraea (strain 34H / ATCC BAA-681) (Vibrio psychroerythus)
Target Names
mntP
Target Protein Sequence
MIEVIILAIALSMDAFAVSIGLGATKQQSKVAPLGIIVALYFGLFQGIMPIIGYLGGKGV LSWAESYTPWIAFLLLFLIGVKMIFDSFSEGIEEDISKITHRVLLILAIATSIDAMAAGF SLTLLPVNPLIACLIIASVTFIFSWLGVLVGTKGGTWLENKAEFVGGITLIVMAIKIIIT S
Uniprot No.

Target Background

Function
This protein likely functions as a manganese efflux pump.
Database Links
Protein Families
MntP (TC 9.B.29) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How do proteins from psychrophilic organisms differ from mesophilic counterparts?

Psychrophilic proteins typically exhibit fundamental differences from their mesophilic counterparts to maintain functionality at low temperatures. Cold-adapted proteins like those from C. psychrerythraea are generally characterized by:

  • Increased structural flexibility, which compensates for reduced molecular motion at low temperatures

  • Decreased stability under ambient laboratory conditions compared to mesophilic or thermophilic proteins

  • Modified amino acid composition that often includes fewer proline and arginine residues

  • Reduced hydrophobic core packing

  • Increased surface hydrophilicity

These adaptations often present challenges for researchers, as psychrophilic proteins may be difficult to work with in laboratory settings. They typically yield lower amounts when expressed recombinantly and can be challenging to stabilize in standard buffer systems . Three-dimensional protein homology modeling comparing bacteria from different optimal growth temperatures suggests specific changes in proteome composition that enhance enzyme effectiveness at low temperatures .

What methodologies are most effective for expressing and purifying recombinant CPS_3146?

Based on experience with other psychrophilic proteins from C. psychrerythraea, several strategies can be employed for optimal expression and purification of CPS_3146:

Expression Systems:

  • Standard E. coli BL21(DE3) systems can be used, but may result in inclusion body formation as observed with other C. psychrerythraea proteins

  • E. coli Arctic Express (DE3) cells, which co-express cold-adapted chaperonins, can improve soluble protein yields at lower induction temperatures (8-15°C)

  • MBP fusion constructs may enhance solubility, as demonstrated with other proteins from this organism

Purification Approaches:

  • For His-tagged CPS_3146:

    • IMAC (immobilized metal affinity chromatography) with careful optimization of imidazole concentrations

    • Consider including glycerol (10-20%) in all buffers to enhance stability

    • Maintain low temperatures (4°C) throughout purification

  • For inclusion body recovery:

    • Denaturant-based solubilization followed by on-column refolding

    • Gradual removal of denaturants using step dialysis at 4°C

A systematic comparison of yields from different expression constructs similar to the approach used for C. psychrerythraea DNA photolyase would be advisable. In that study, researchers tested:

  • pET-14b vector in BL21(DE3) cells (inclusion bodies)

  • 6×-HisTag constructs in Arctic Express (DE3) cells (soluble fraction)

  • MBP fusion in BL21(DE3) cells (soluble fraction)

How can structural adaptation mechanisms of CPS_3146 be investigated?

Investigating the structural adaptations of CPS_3146 requires a multi-faceted approach:

Comparative Sequence Analysis:

  • Align CPS_3146 with homologous UPF0059 family proteins from mesophilic and thermophilic organisms

  • Analyze amino acid composition differences, particularly focusing on charged residues, proline content, and hydrophobic core residues

  • Identify potential flexibility-enhancing substitutions

Homology Modeling:

  • Generate 3D structural models comparing CPS_3146 to mesophilic homologs

  • Analyze differences in:

    • Electrostatic surface potential

    • Hydrogen bonding networks

    • Salt bridge formation

    • Hydrophobic core packing

Biophysical Characterization:

  • Circular dichroism (CD) spectroscopy to assess secondary structure stability across temperature ranges

  • Differential scanning calorimetry to determine melting temperature and thermodynamic parameters

  • Fluorescence spectroscopy to monitor tertiary structure changes

What approaches can determine the membrane topology and function of CPS_3146?

Determining membrane topology and function of CPS_3146 requires specialized techniques:

Topology Prediction and Validation:

  • Computational prediction using tools like TMHMM, TOPCONS, and PredictProtein

  • Experimental validation through:

    • PhoA/LacZ fusion assays

    • Cysteine scanning mutagenesis with membrane-impermeable labeling reagents

    • Protease protection assays

Functional Characterization Approaches:

  • Liposome reconstitution assays to test potential:

    • Transport activity

    • Channel formation

    • Membrane stabilization at low temperatures

  • Interaction studies using:

    • Co-immunoprecipitation

    • Bacterial two-hybrid systems

    • Cross-linking coupled with mass spectrometry

Localization Studies:

  • GFP fusion constructs to confirm membrane localization in heterologous systems

  • Immunogold electron microscopy using anti-His antibodies

  • Membrane fractionation followed by Western blotting

When designing these studies, consider the distinct properties of C. psychrerythraea's membranes, which likely have adaptations for maintaining fluidity at low temperatures .

How should activity assays be optimized for cold-adapted membrane proteins like CPS_3146?

Optimizing activity assays for cold-adapted membrane proteins requires careful consideration of temperature, buffer composition, and detection methods:

Temperature Considerations:

  • Perform assays at multiple temperatures (0-25°C) to determine optimal activity range

  • Include preincubation steps at different temperatures to assess thermal stability

  • Use temperature-controlled cuvettes or plate readers capable of sub-zero temperatures when possible

Buffer Optimization:

  • Test buffers with different ionic strengths (50-300 mM)

  • Evaluate pH ranges broader than standard (pH 5-9)

  • Include cryoprotectants such as glycerol (5-20%) or trehalose (100-500 mM)

  • Consider adding osmolytes found in the native marine environment

Membrane Mimetic Systems:

  • Detergent micelles (DDM, LDAO) at concentrations minimally exceeding CMC

  • Liposomes with varying lipid compositions, including:

    • Higher unsaturated fatty acid content

    • Shorter chain lipids

    • Inclusion of bacterial lipids if available

Control Experiments:

  • Always include parallel assays with mesophilic homologs for direct comparison

  • Use both active enzyme and heat-inactivated controls

  • Include measurements of background activity in the expression host

When designing these assays, remember that C. psychrerythraea proteins are generally less stable under standard laboratory conditions than their mesophilic counterparts , necessitating careful handling and optimization of assay conditions.

What considerations are important when designing site-directed mutagenesis studies for CPS_3146?

Site-directed mutagenesis studies for CPS_3146 should be designed with careful consideration of cold-adaptation features:

Target Selection Strategy:

  • Identify residues unique to psychrophilic orthologs through multiple sequence alignments

  • Focus on:

    • Charged residues on protein surface

    • Glycine residues in loop regions

    • Hydrophobic core residues

    • Proline residues in secondary structure elements

Mutation Design Principles:

  • "Psychrophile-to-mesophile" mutations:

    • Replace flexible residues with more rigid counterparts

    • Introduce stabilizing interactions (salt bridges, H-bonds)

  • "Mesophile-to-psychrophile" mutations in mesophilic homologs:

    • Replace rigid residues with more flexible ones

    • Disrupt stabilizing interactions

Controls and Validation:

  • Create conservative mutations as controls

  • Perform reciprocal mutations in mesophilic homologs

  • Consider generating multiple mutations to address potential functional redundancy

Assessment Methods:

  • Thermal stability measurements by DSC or CD

  • Activity assays at different temperatures (0-30°C)

  • Expression and folding efficiency comparisons

When designing these experiments, remember that the psychrophilic lifestyle in C. psychrerythraea is likely conferred by synergistic changes across the proteome rather than by individual adaptations , so multiple mutations may be necessary to observe significant effects.

How can protein-protein interaction studies be designed to identify CPS_3146 binding partners?

Identifying binding partners of CPS_3146 requires specialized approaches for membrane proteins from psychrophilic organisms:

In vivo Approaches:

  • Bacterial two-hybrid systems:

    • Use low-temperature adapted variants

    • Express at temperatures between 8-15°C

    • Consider C. psychrerythraea genomic libraries as prey

  • Co-immunoprecipitation:

    • Perform cell lysis and all procedures at 4°C

    • Use crosslinking agents effective at low temperatures

    • Include adequate controls with non-specific His-tagged proteins

In vitro Methods:

  • Pull-down assays:

    • Immobilize purified His-tagged CPS_3146

    • Use C. psychrerythraea cell lysates as prey

    • Perform binding and washing steps at 4°C

  • Surface plasmon resonance:

    • Immobilize CPS_3146 in detergent micelles or nanodiscs

    • Test binding kinetics at multiple temperatures (4-20°C)

    • Use gradual flow rates to accommodate slower binding kinetics

Proximity-based Methods:

  • BioID or APEX2 proximity labeling:

    • Generate fusion constructs with CPS_3146

    • Express in Arctic Express E. coli

    • Perform labeling at lower temperatures with extended reaction times

Data Analysis Considerations:

  • Account for temperature effects on binding affinities

  • Consider slower association/dissociation kinetics at lower temperatures

  • Use appropriate statistical methods to identify significant interactions versus background

When designing these studies, remember that protein-protein interactions may be temperature-dependent, with different interaction profiles at low versus ambient temperatures.

How should researchers interpret differences in thermal stability parameters between CPS_3146 and mesophilic homologs?

Interpreting thermal stability differences between CPS_3146 and mesophilic homologs requires careful analysis:

Expected Parameters and Their Interpretation:

ParameterExpected TrendInterpretation
Tm (melting temperature)Lower for CPS_3146Reflects decreased stability at higher temperatures
ΔH (enthalpy change)Lower for CPS_3146Indicates fewer or weaker stabilizing interactions
ΔG (Gibbs free energy)Similar at physiological tempsProteins evolved for similar stability in their native environments
Activation energyLower for CPS_3146Enables function at lower kinetic energy environments
Temperature optimumShifted downwardAdaptation to function at lower temperatures

Key Analysis Approaches:

  • Generate stability curves across temperatures (0-40°C)

  • Calculate thermodynamic parameters using appropriate models

  • Compare relative changes in parameters rather than absolute values

  • Normalize data to account for protein size differences

Contextual Interpretation:

  • Lower thermal stability is often a trade-off for increased catalytic efficiency at low temperatures

  • Similar activity at low temperatures between psychrophilic and mesophilic proteins, with psychrophilic proteins showing higher activity at low temperatures, would indicate successful cold adaptation

  • Higher flexibility in binding regions may represent an adaptation to maintain substrate interactions at reduced temperatures

When analyzing these differences, remember that psychrophilic proteins like those from C. psychrerythraea typically show modest FAD vibronic structure, suggesting more flexible binding pockets than warmer counterparts .

What bioinformatic approaches can predict cold-adaptation features in CPS_3146?

Multiple bioinformatic approaches can be employed to predict cold-adaptation features in CPS_3146:

Sequence-Based Analysis:

  • Amino acid composition analysis:

    • Calculate relative frequencies of amino acids compared to mesophilic homologs

    • Identify deviations in charged residues, glycine, proline, and hydrophobic residues

  • Local flexibility prediction:

    • Use tools like DynaMine, FlexPred, or PROFbval

    • Identify regions predicted to have higher flexibility

Structure-Based Analysis:

  • Homology modeling:

    • Generate models based on templates from various temperature optima

    • Compare predicted surface charge distributions

    • Analyze predicted hydrophobic core packing

  • Molecular dynamics simulations:

    • Run simulations at different temperatures (0-30°C)

    • Analyze protein flexibility, particularly in loop regions

    • Calculate root mean square fluctuations (RMSF)

Comparative Genomic Approaches:

  • Analyze codon usage bias in the CPS_3146 gene

  • Compare with genome-wide patterns in C. psychrerythraea

  • Correlate with G+C content (37.5-37.9% for C. psychrerythraea)

Implementation Strategy:

  • Begin with basic sequence analysis

  • Progress to more computationally intensive structure predictions

  • Validate predictions with experimental data when available

  • Use ensemble approaches combining multiple prediction methods

When performing these analyses, consider that genome-wide studies suggest psychrophilic adaptations involve synergistic changes rather than a unique set of genes or features .

How can researchers differentiate between general membrane protein properties and cold-specific adaptations in CPS_3146?

Differentiating general membrane protein properties from cold-specific adaptations requires careful comparative analysis:

Systematic Comparison Framework:

  • Three-way comparison approach:

    • CPS_3146 vs. mesophilic UPF0059 homologs (temperature effect)

    • CPS_3146 vs. other C. psychrerythraea membrane proteins (protein family effect)

    • CPS_3146 vs. non-membrane psychrophilic proteins (membrane localization effect)

  • Controlled mutation studies:

    • Mutate residues unique to psychrophilic homologs

    • Test both membrane stability and temperature sensitivity

Specific Analysis Methods:

  • Membrane integration efficiency:

    • Compare in vitro translation/insertion systems at different temperatures

    • Analyze membrane integration at 4°C vs. 30°C

  • Membrane fluidity adaptation:

    • Test protein function in liposomes with varying fluidity

    • Compare activity in native-like vs. rigid membrane mimetics

Data Integration Approach:

  • Create correlation matrices between sequence features and cold adaptation

  • Use principal component analysis to identify features that segregate with temperature adaptation versus membrane localization

  • Employ machine learning approaches trained on known cold-adapted proteins

Decision Framework:
Features likely to be cold-specific adaptations:

  • Present in multiple psychrophilic proteins across different families

  • Correlate with optimal growth temperature in homologs

  • Affect function/stability differently at low versus ambient temperatures

  • Absent in mesophilic membrane proteins

When conducting these analyses, remember that modeling of three-dimensional protein homology from bacteria representing a range of optimal growth temperatures suggests specific proteome composition changes that enhance enzyme effectiveness at low temperatures .

What strategies can overcome low expression yields of recombinant CPS_3146?

Low expression yields are common with psychrophilic proteins like CPS_3146. Several strategies can address this challenge:

Expression System Optimization:

  • Use specialized strains:

    • Arctic Express (DE3) containing cold-adapted chaperonins Cpn10 and Cpn60

    • BL21(DE3) with co-expression of chaperones (GroEL/ES, DnaK/DnaJ)

    • C41/C43(DE3) designed for membrane protein expression

  • Vector and fusion partner optimization:

    • Test MBP fusions (significantly improved yields for other C. psychrerythraea proteins)

    • SUMO fusions to enhance folding

    • Periplasmic targeting for potential better folding

Expression Condition Adjustments:

  • Temperature optimization:

    • Lower induction temperatures (8-15°C)

    • Extended expression times (24-72 hours)

  • Media and induction adjustments:

    • Use auto-induction media for gradual protein production

    • Lower IPTG concentrations (0.01-0.1 mM)

    • Supplement with osmolytes (glycine betaine, trehalose)

Cell-Free Expression Alternatives:

  • E. coli-based cell-free systems at reduced temperatures

  • Addition of detergents or liposomes for membrane protein folding

  • Supplementation with psychrophilic chaperones if available

Recovery Strategies:

  • For inclusion body formation:

    • Optimize solubilization conditions with various detergents

    • Implement step-wise refolding protocols

    • Use high-throughput refolding screens

These approaches should be systematically tested, as different C. psychrerythraea proteins respond differently to expression strategies, as shown with the DNA photolyase which was successfully expressed using three different approaches with varying yields .

How can researchers address protein stability issues when working with CPS_3146?

Addressing stability issues with psychrophilic proteins like CPS_3146 requires specialized approaches:

Buffer Optimization:

  • Cryoprotectant addition:

    • Glycerol (10-25%)

    • Trehalose (100-500 mM)

    • Glycine betaine (1-5 mM)

  • pH optimization:

    • Test wider pH ranges (pH 5-9)

    • Consider native pH of C. psychrerythraea environment

  • Ionic strength adjustment:

    • Higher salt concentrations can stabilize some psychrophilic proteins

    • Test NaCl ranges from 100-500 mM

Stabilization Strategies:

  • For membrane proteins:

    • Identify optimal detergent or lipid environments

    • Test detergent mixtures rather than single detergents

    • Consider nanodiscs or amphipols for enhanced stability

  • Storage conditions:

    • Flash freezing in liquid nitrogen often better than slow freezing

    • Addition of sucrose (5-10%) before freezing

    • Aliquoting to minimize freeze-thaw cycles

Chemical Modification Approaches:

  • Surface cysteine blocking to prevent aggregation

  • Limited crosslinking to maintain tertiary structure

  • Targeted disulfide introduction through mutagenesis

Handling Recommendations:

  • Maintain samples at 4°C during all procedures

  • Use pre-chilled buffers and equipment

  • Process samples quickly to minimize time at room temperature

  • Consider specialized low-temperature equipment for purification

When implementing these strategies, remember that psychrophilic proteins like those from C. psychrerythraea are generally less stable under standard laboratory conditions than their mesophilic counterparts, making stabilization particularly challenging .

What are common pitfalls in functional characterization of cold-adapted membrane proteins?

Functional characterization of cold-adapted membrane proteins presents several challenges researchers should anticipate:

Temperature-Related Challenges:

  • Assay temperature discrepancies:

    • Problem: Testing at non-physiological temperatures leads to misleading activity data

    • Solution: Perform assays across temperature ranges (0-30°C)

    • Control: Include both psychrophilic and mesophilic controls tested under identical conditions

  • Temperature fluctuations during purification:

    • Problem: Protein denaturation during room-temperature steps

    • Solution: Maintain cold chain throughout all procedures

    • Validation: Monitor protein integrity before and after each major purification step

Membrane Environment Issues:

  • Inappropriate membrane mimetics:

    • Problem: Standard detergents may not preserve native structure

    • Solution: Screen multiple detergent classes and membrane mimetics

    • Approach: Consider native-like lipid compositions with higher unsaturated fatty acid content

  • Microdomain disruption:

    • Problem: Loss of functional complexes during solubilization

    • Solution: Milder solubilization strategies, co-purification approaches

    • Validation: Activity tests in different reconstitution systems

Methodological Pitfalls:

  • Inappropriate enzyme kinetics models:

    • Problem: Standard Michaelis-Menten analysis may not apply at low temperatures

    • Solution: Consider temperature-dependent kinetic models

    • Approach: Measure complete temperature profiles rather than single points

  • Insufficient sensitivity in assays:

    • Problem: Lower activity at low temperatures may fall below detection limits

    • Solution: Develop high-sensitivity assays with longer incubation times

    • Validation: Include appropriate negative and positive controls

When designing these studies, remember that comparative genome analyses suggest that psychrophilic adaptations are the result of synergistic changes rather than individual features , making functional characterization particularly complex.

How might structural studies of CPS_3146 advance our understanding of cold adaptation?

Structural studies of CPS_3146 could provide significant insights into cold adaptation mechanisms in several ways:

High-Resolution Structure Determination:

  • Cryo-electron microscopy approaches:

    • Particularly suitable for membrane proteins

    • Can capture conformational ensembles

    • May reveal flexibility characteristics unique to psychrophilic proteins

  • X-ray crystallography challenges and strategies:

    • Difficulty: Obtaining crystals due to inherent flexibility

    • Approach: Surface entropy reduction mutants

    • Method: Crystallization at lower temperatures with cryo-protectants

  • NMR spectroscopy for dynamics studies:

    • Hydrogen-deuterium exchange rates to map flexibility

    • Relaxation measurements to quantify motion

    • Temperature-dependent chemical shift analysis

Comparative Structural Analysis:

  • Mapping of regions with increased flexibility compared to mesophilic homologs

  • Identification of reduced hydrophobic core packing

  • Quantification of hydrogen bonding networks and salt bridge differences

  • Analysis of protein breathing motions at different temperatures

Structure-Function Correlation:

  • Identifying structural elements that maintain function at low temperatures

  • Mapping temperature-sensitive regions within the protein

  • Engineering stabilized variants with maintained cold activity

What evolutionary insights could be gained from comparative genomic studies of UPF0059 family proteins?

Comparative genomic studies of UPF0059 family proteins across temperature-diverse organisms could yield valuable evolutionary insights:

Phylogenetic Pattern Analysis:

  • Construction of temperature-annotated phylogenetic trees

  • Identification of convergent evolution patterns in cold-adapted lineages

  • Correlation of sequence features with optimal growth temperatures

Evolutionary Rate Analysis:

  • Comparison of synonymous vs. non-synonymous substitution rates

  • Identification of positively selected residues in psychrophilic lineages

  • Analysis of codon usage bias patterns in relation to temperature adaptation

Genomic Context Examination:

  • Analysis of operon structures containing UPF0059 genes

  • Identification of co-evolved gene clusters

  • Comparative analysis of regulatory elements and promoter regions

Horizontal Gene Transfer Investigation:

  • Assessment of potential horizontal gene transfer events

  • Analysis similar to that performed for compatible solute catabolism genes in C. psychrerythraea

  • Identification of potential acquisition of cold-adaptation features

What biotechnological applications could be developed based on CPS_3146 properties?

The unique properties of cold-adapted proteins like CPS_3146 from C. psychrerythraea offer several promising biotechnological applications:

Cold-Active Biocatalysts:

  • Development of temperature-sensitive expression systems:

    • Using CPS_3146 as a model for designing membrane-associated genetic switches

    • Creating temperature-controlled protein localization systems

    • Engineering biosensors functional at low temperatures

  • Membrane protein scaffolds:

    • Design of cold-stable membrane protein platforms

    • Development of low-temperature bioconjugation strategies

    • Creation of psychrophilic membrane fusion proteins

Environmental Biotechnology:

  • Bioremediation applications:

    • Engineered systems for cold environment pollutant degradation

    • Design of cold-active transport proteins for contaminant removal

    • Development of whole-cell biosensors for Arctic/Antarctic monitoring

  • Low-energy bioprocessing:

    • Membrane protein components for low-temperature fermentation

    • Reduced energy input requirements for industrial processes

    • Cold-active transport systems for pharmaceutical production

Structural Biotechnology Innovations:

  • Novel membrane protein stabilization strategies:

    • Identification of cold-stability motifs transferable to other proteins

    • Development of enhanced heterologous expression systems

    • Design of chimeric proteins with cold-adapted domains

  • Cryopreservation improvements:

    • Membrane-protective additives based on CPS_3146 properties

    • Cell membrane stabilization technologies

    • Engineered freeze-resistant cell membranes

These applications would leverage the inherent properties of cold-adapted proteins from C. psychrerythraea, which have evolved capabilities important to carbon and nutrient cycling, bioremediation, and production of cold-adapted enzymes , extending these natural adaptations to biotechnological contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.