Recombinant Comephorus dybowskii Rhodopsin (rho)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All protein shipments are standardly accompanied by blue ice packs. If dry ice shipping is required, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
rho; Rhodopsin; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-289
Protein Length
full length protein
Species
Comephorus dybowskii
Target Names
rho
Target Protein Sequence
YLVNPAAYAALGAYMFLLILIGFPVNFLTLYVTLEHKKLRTPLNYILLNLAVADLFMVLG GFTTTMYTSMHGYFVLGRLGCNLEGFFATLGGEIALWSLVVLAIERWIVVCKPISNFRFT EDHAIMGLAFSWVMALSCSVPPLVGWSRYIPEAMQCSCGVDYYTRAEGFNTESFVLYMFT VHFLIPLSVIFFCYGRLLCAVKEAAAAQQESETTQRSEKEVSRMVVLMVIGFLVCWLPYA STAWWIFCNQGSEFGPVFMTIPAFFAKSSAIYNPMIYICMNKQFRHCMI
Uniprot No.

Target Background

Function
Rhodopsin is a photoreceptor essential for image-forming vision under low light conditions. While most saltwater fish species utilize retinal as a chromophore, most freshwater fish utilize 3-dehydroretinal or a mixture of retinal and 3-dehydroretinal. Light-induced isomerization of 11-cis to all-trans retinal triggers a conformational change that activates signaling through G-proteins. Subsequent receptor phosphorylation mediates displacement of the bound G-protein alpha subunit by arrestin, terminating the signaling process.
Protein Families
G-protein coupled receptor 1 family, Opsin subfamily
Subcellular Location
Membrane; Multi-pass membrane protein. Cell projection, cilium, photoreceptor outer segment.

Q&A

What is Comephorus dybowskii Rhodopsin and why is it significant for research?

Comephorus dybowskii Rhodopsin (rho) is a G protein-coupled receptor (GPCR) found in the Little Baikal oilfish endemic to Lake Baikal in Eastern Siberia. This visual pigment belongs to the broader family of rhodopsins that function as light-sensitive receptors. The significance of studying this particular rhodopsin lies in understanding evolutionary adaptations of visual systems in unique aquatic environments, particularly deep freshwater ecosystems like Lake Baikal.

As GPCRs constitute the largest family of integral membrane proteins and are critical targets for drug development, Comephorus dybowskii Rhodopsin serves as a valuable model system for understanding GPCR structure-function relationships. The protein's amino acid sequence (UniProt NO.: O42327) reveals important structural features typical of vertebrate rhodopsins while maintaining species-specific adaptations .

What expression systems are optimal for producing recombinant Comephorus dybowskii Rhodopsin?

Multiple expression systems can be utilized for the production of Recombinant Comephorus dybowskii Rhodopsin, each with distinct advantages:

Expression SystemAdvantagesConsiderations
E. coliBest yields, shorter turnaround timesLimited post-translational modifications
YeastGood yields, moderate processing timeSome eukaryotic modifications
Insect cells with baculovirusMany post-translational modificationsMore complex methodology
Mammalian cellsNative-like post-translational modificationsLower yields, longer production times

How can researchers effectively reconstitute Comephorus dybowskii Rhodopsin with chromophore for functional studies?

Successful reconstitution of Comephorus dybowskii Rhodopsin with its chromophore is critical for functional studies. The methodology involves:

  • Chromophore preparation: Either 11-cis-retinal or 11-cis-3-hydroxyretinal can be used, with the latter thought to be the native chromophore in some insect rhodopsins. The chromophore should be prepared in a dark environment to prevent photoisomerization .

  • Reconstitution protocol:

    • Express and purify the opsin (apoprotein without retinal)

    • Add chromophore in slight molar excess (typically 1.1-1.5×)

    • Perform reconstitution in appropriate buffer conditions (pH ~7.4)

    • Incubate in darkness or under dim red light for sufficient time to allow Schiff base formation

    • Solubilize with a mild detergent such as n-dodecyl-β-D-maltoside (DM)

  • Verification of successful reconstitution:

    • Measure absorbance spectrum to confirm formation of the characteristic rhodopsin peak

    • Perform photobleaching experiments by exposing to light and measuring spectral shifts

    • Calculate the A280/Amax ratio to assess the proportion of properly folded rhodopsin

  • Functional testing:

    • Measure G protein activation efficiency of the reconstituted protein

    • Compare activity between dark and light-activated states

Research with other rhodopsins has shown that UV light irradiation of reconstituted pigments results in absorbance decreases in the UV region and increases in the visible region, confirming successful chromophore isomerization .

What site-directed mutagenesis approaches are most informative for structure-function studies of Comephorus dybowskii Rhodopsin?

Site-directed mutagenesis is a powerful tool for investigating structure-function relationships in rhodopsins. Based on previous studies of rhodopsin mutations, the following approaches are recommended:

  • Target selection strategies:

    • Conserved functional residues: Mutations in the retinal binding pocket (e.g., equivalent to E122G in bovine rhodopsin) can significantly alter spectral properties and Meta II stability .

    • Intradiscal domain: Mutations in regions corresponding to the N-terminus and extracellular loop 1 (EL1) can affect protein stability and G protein activation .

    • Helix 8 region: In vertebrate rhodopsins, this region is critical for proper trafficking and G protein interaction .

    • Spectral tuning sites: Based on studies of blue cone opsins in cottoid fishes, positions 118, 215, and 269 are key sites that influence spectral tuning .

  • Functional characterization metrics:

    • Measurement of absorption maximum (λmax) shifts

    • Meta II decay rates (wild-type bovine rhodopsin: ~17.68 min)

    • G protein activation efficiency (reported as percentage relative to wild-type)

    • Photobleaching characteristics

    • Temperature sensitivity

  • Types of mutations to consider:

    • Conservative substitutions that maintain amino acid properties

    • Non-conservative substitutions that alter charge, polarity, or size

    • Mutations that mimic naturally occurring variants in related species

Previous research demonstrated that mutations like E122G shifted λmax to 481 nm and doubled Meta II half-life, while S298D exhibited abnormal photobleaching and a Meta II half-life 4× shorter than wild-type .

What are the optimal storage and handling conditions for maintaining activity of recombinant Comephorus dybowskii Rhodopsin?

To maintain the structural integrity and functional activity of recombinant Comephorus dybowskii Rhodopsin, the following storage and handling conditions are recommended:

  • Storage buffer:

    • Tris-based buffer with 50% glycerol, specifically optimized for this protein

  • Temperature conditions:

    • Store at -20°C for regular use

    • For extended storage, conserve at -80°C

    • Working aliquots can be maintained at 4°C for up to one week

  • Critical handling considerations:

    • Repeated freezing and thawing is not recommended as it can lead to protein denaturation

    • Create small working aliquots to minimize freeze-thaw cycles

    • For light-sensitive experiments, handle under dim red light conditions

    • Consider addition of stabilizing agents such as specific lipids or cholesterol for long-term stability

  • Quality control measures:

    • Periodically verify protein integrity through absorption spectroscopy

    • Monitor the A280/Amax ratio to assess the proportion of properly folded protein

    • Conduct functional assays to confirm retention of activity after storage

How does the structure of Comephorus dybowskii Rhodopsin compare to other vertebrate rhodopsins?

Comparative analysis of Comephorus dybowskii Rhodopsin with other vertebrate rhodopsins reveals important structural similarities and differences:

  • Conserved structural elements:

    • Seven-transmembrane domain architecture typical of Class A GPCRs

    • Key residues for chromophore binding, including the conserved lysine that forms the Schiff base with retinal

    • Amphipathic helix 8 following the seventh transmembrane domain

    • Potential palmitoylation sites that anchor the C-terminal region to the membrane

  • C-terminal region:

    • Likely contains the QVxPA motif characteristic of vertebrate rhodopsins, which is important for proper trafficking to the photoreceptor membrane

    • This differs significantly from invertebrate rhodopsins (like Drosophila rhodopsin), which do not rely on this motif for targeting

  • Spectral tuning residues:

    • Contains specific amino acids in the retinal binding pocket that determine its absorption maximum

    • These residues may reflect adaptation to the light environment of Lake Baikal

  • G protein interaction domains:

    • Contains cytoplasmic loop regions responsible for G protein coupling

    • The sequence of these regions determines the specificity and efficiency of G protein activation

Unlike Drosophila rhodopsin, where helix 8 plays a crucial role in targeting to rhabdomeres, vertebrate rhodopsins like Comephorus dybowskii rely more on the C-terminal QVxPA motif for proper membrane localization .

What evolutionary insights can be gained from studying Comephorus dybowskii Rhodopsin?

Comephorus dybowskii Rhodopsin provides valuable insights into the evolution of visual systems, particularly in unique aquatic environments:

  • Adaptation to Lake Baikal environment:

    • Comephorus dybowskii (Little Baikal oilfish) has evolved in the specific light conditions of Lake Baikal, the world's deepest and oldest freshwater lake

    • Spectral properties of its rhodopsin likely reflect adaptation to these unique conditions, including light penetration at depth

    • Comparative analysis with rhodopsins from other Lake Baikal cottoid fishes can reveal parallel or convergent evolution

  • Evolutionary patterns across cottoid fishes:

    • Studies of cottoid fish from Lake Baikal have revealed important patterns in visual pigment evolution

    • Specific amino acid substitutions at key sites (positions 118, 215, and 269) have been identified as critical for spectral tuning in blue cone opsins of these fishes

  • Molecular phylogenetics:

    • Sequence analysis of Comephorus dybowskii Rhodopsin in relation to other vertebrate rhodopsins provides insights into evolutionary relationships

    • Comparison with other visual pigments helps trace the evolutionary history of visual systems

  • Adaptation mechanisms:

    • Identification of sites under positive selection pressure can reveal mechanisms of adaptive evolution

    • Comparison between duplicate genes (as seen in goldfish due to tetraploidy) versus single-copy genes in Comephorus dybowskii provides insights into gene evolution after duplication events

What spectroscopic methods are most informative for characterizing Comephorus dybowskii Rhodopsin?

Several complementary spectroscopic techniques provide comprehensive characterization of Comephorus dybowskii Rhodopsin:

  • UV-Visible spectroscopy:

    • Determination of absorption maximum (λmax) in the dark state

    • Monitoring spectral shifts upon photobleaching

    • Measuring difference spectra before and after light exposure to identify photointermediates

    • Quantification of Meta II decay rates

  • Fluorescence spectroscopy:

    • Analysis of intrinsic tryptophan fluorescence to probe structural changes

    • Use of fluorescent ligands to study binding kinetics

    • Monitoring conformational changes through site-specific fluorescent labels

  • Circular dichroism (CD) spectroscopy:

    • Assessment of secondary structure composition

    • Monitoring thermal stability

    • Detection of structural changes upon photoactivation

  • Solid-state Magic Angle Spinning NMR:

    • Provides adaptive method for analyzing structure, dynamics, and intermolecular interactions

    • Can examine structure and dynamics at specific locations across the protein

    • Samples can be studied in various states (detergents, liposomes)

    • Low-temperature conditions allow capture of active states

  • Fourier Transform Infrared (FTIR) spectroscopy:

    • Detection of subtle structural changes

    • Identification of specific bond vibrations associated with photoactivation

Previous research with rhodopsin mutants has used these techniques to measure parameters such as Meta II half-life (wild-type: ~17.68 min) and photobleaching characteristics .

How can G protein activation by Comephorus dybowskii Rhodopsin be quantitatively measured?

Quantitative assessment of G protein activation by Comephorus dybowskii Rhodopsin involves multiple complementary approaches:

  • Direct G protein activation assays:

    • GTPγS binding assays to measure nucleotide exchange on the G protein (likely transducin for vertebrate rhodopsins)

    • Measure activation under different light conditions (dark state versus light-activated)

    • Compare activation efficiency between wild-type and mutant forms

  • Functional metrics:

    • Percentage of G protein activation relative to a reference standard (e.g., bovine rhodopsin)

    • Rate of activation (initial velocity of GTPγS binding)

    • Maximum activation achieved (plateau level)

    • Duration of the active state (Meta II stability)

  • Experimental design considerations:

    • Use purified components (rhodopsin and G protein) for direct measurement

    • Ensure proper reconstitution with chromophore

    • Control light conditions carefully to distinguish between dark and light-activated states

    • Include positive controls (e.g., well-characterized rhodopsins) and negative controls (e.g., opsin without chromophore)

  • Data interpretation:

    • Compare activation metrics with other vertebrate rhodopsins

    • Correlate with structural features and spectral properties

    • For mutant forms, relate activation changes to specific structural alterations

Studies with other rhodopsins have shown that mutations in specific regions can significantly impact G protein activation efficiency, with some mutants exhibiting decreased transducin activation (35%, 64%, and 18% relative to wild-type for specific variants) .

What approaches can be used to study the photocycle kinetics of Comephorus dybowskii Rhodopsin?

Comprehensive characterization of photocycle kinetics in Comephorus dybowskii Rhodopsin requires multiple analytical approaches:

  • Time-resolved spectroscopy:

    • Rapid scanning UV-visible spectroscopy to capture spectral intermediates

    • Flash photolysis to initiate synchronized photoisomerization

    • Measurement of the formation and decay of key intermediates:

      • Photorhodopsin → Bathorhodopsin → Lumirhodopsin → Metarhodopsin I → Metarhodopsin II

    • Determination of rate constants for each transition

  • Meta II stability measurements:

    • Monitoring the decay of the Meta II intermediate, which represents the active signaling state

    • Typical Meta II half-life for vertebrate rhodopsins is ~15-20 minutes (17.68 min reported for wild-type in comparative studies)

    • Environmental factors affecting stability (pH, temperature, ionic strength)

  • Retinal release kinetics:

    • Following the hydrolysis of the Schiff base and release of all-trans-retinal

    • Using fluorescence enhancement upon retinal release from the binding pocket

    • Correlating with Meta II decay

  • Low-temperature stabilization techniques:

    • Capture specific photointermediates by conducting experiments at reduced temperatures

    • Solid-state Magic Angle Spinning NMR under low-temperature conditions to examine active states

    • Progressive warming to allow sequential transitions between intermediates

Previous studies have demonstrated that mutations can significantly alter photocycle kinetics, with variants showing Meta II decay rates ranging from 5.96 to 10.06 minutes compared to the wild-type value of 17.68 minutes .

How can Comephorus dybowskii Rhodopsin contribute to understanding retinitis pigmentosa and other visual disorders?

Comephorus dybowskii Rhodopsin provides a valuable comparative model for studying mechanisms underlying retinal diseases:

  • Structural insights into disease-causing mutations:

    • Recombinant Comephorus dybowskii Rhodopsin can be engineered to incorporate mutations analogous to those causing retinitis pigmentosa (RP) in humans

    • The PiggyBac transposon system allows rapid generation of multiple mutant variants for comparative analysis

    • Understanding how specific mutations affect protein stability, folding, and function across species helps identify fundamental versus species-specific mechanisms

  • Classification of mutation effects:

    • Mutations can be categorized based on their effects:

      • Class One: Mutations affecting folding and transport (e.g., P23H)

      • Class Two: Mutations affecting post-Golgi trafficking

      • Class Three: Mutations disrupting endocytosis and vesicular trafficking

      • Class Four: Mutations causing abnormal post-translational modifications and protein instability

  • Therapeutic strategy development:

    • Testing potential pharmacological chaperones (e.g., 9-cis-retinal, 11-cis-retinal) for rescuing misfolded rhodopsin mutants

    • Previous studies showed that such chaperones can restore pigment levels to 50-100% of wild-type

    • Comparative analysis across species helps identify universally effective approaches versus species-specific interventions

  • Structure-function relationship insights:

    • Understanding how specific domains (e.g., N-terminus, extracellular loop 1) contribute to rhodopsin stability and function

    • Temperature-sensitivity experiments revealing conditional defects in protein expression and trafficking

    • Correlation between spectroscopic properties, G protein activation, and structural integrity

Research has shown that mutations like P23A, G101V, and G106W exhibit temperature-sensitive expression defects, with improved expression at 33°C compared to 37°C, providing insights into potential therapeutic approaches .

What insights can comparing vertebrate and invertebrate rhodopsins provide when using Comephorus dybowskii as a model?

Comparative analysis between Comephorus dybowskii Rhodopsin (vertebrate) and invertebrate rhodopsins reveals fundamental differences in structure, function, and trafficking:

  • Targeting mechanisms:

    • Vertebrate rhodopsins like Comephorus dybowskii rely on the C-terminal QVxPA motif for proper trafficking to photoreceptor membranes

    • Invertebrate rhodopsins (e.g., Drosophila Rh1) use different mechanisms, with helix 8 playing a crucial role in targeting to rhabdomeres

    • This represents a major evolutionary divergence in visual systems

  • Structural comparison:

    • Helix 8 in vertebrate and invertebrate rhodopsins shows different patterns of conservation

    • In invertebrate rhabdomeric opsins, the PKYRxxLxxR/K motif in helix 8 is highly conserved

    • The C-terminus beyond helix 8 shows high variability in invertebrates but is more conserved in vertebrates

  • Functional differences:

    • Vertebrate rhodopsins are typically "monostable," releasing retinal upon photoisomerization

    • Many invertebrate rhodopsins are "bistable," with retinal remaining bound and capable of re-isomerization upon absorption of a second photon

    • Comephorus dybowskii Rhodopsin likely follows the vertebrate monostable pattern

  • G protein coupling specificity:

    • Vertebrate rhodopsins typically couple to transducin (Gt)

    • Invertebrate rhodopsins often couple to Gq-type G proteins

    • These differences affect downstream signaling cascades and cellular responses

Despite these differences, both systems share fundamental mechanisms of light reception through retinal isomerization, making comparative studies valuable for understanding core principles of photoreception .

How can structural studies of Comephorus dybowskii Rhodopsin inform GPCR drug discovery?

Structural characterization of Comephorus dybowskii Rhodopsin provides valuable insights for GPCR drug discovery:

  • Comparative structural analysis:

    • Rhodopsins serve as prototypical GPCRs with well-established structural features

    • Comparing structures across species helps identify both conserved functional domains and variable regions

    • Understanding these patterns informs rational drug design targeting specific GPCR subfamilies

  • Ligand binding pocket characterization:

    • The retinal binding pocket in rhodopsin provides a model for understanding ligand-receptor interactions

    • Species-specific variations in binding pocket architecture inform structure-based drug design

    • Identification of conserved residues critical for activation versus species-specific residues

  • Activation mechanism insights:

    • Detailed understanding of the transition from inactive to active conformations

    • Identification of key structural changes during activation that can be targeted by drugs

    • Comparison between monostable vertebrate rhodopsins and bistable invertebrate rhodopsins reveals different activation architectures that inform drug design strategies

  • Development of expression and purification methods:

    • Optimization of recombinant expression systems for Comephorus dybowskii Rhodopsin contributes to general methodologies for difficult-to-express GPCRs

    • The PiggyBac transposon system provides a rapid approach for generating stable cell lines expressing various GPCR mutants

    • Purification protocols developed for rhodopsins can be adapted for other membrane proteins

Studies have demonstrated that the PiggyBac transposon system enables high-level expression of rhodopsin variants, facilitating structural studies and providing a platform for screening potential therapeutic compounds .

What are the main technical challenges in working with Comephorus dybowskii Rhodopsin and how can they be addressed?

Working with Comephorus dybowskii Rhodopsin presents several technical challenges that require specific methodological solutions:

  • Expression and yield optimization:
    Challenge: Obtaining sufficient quantities of properly folded protein
    Solutions:

    • Use the PiggyBac transposon system with tetracycline-inducible promoters for stable cell line generation

    • Include sodium butyrate in induction media to enhance gene expression

    • Utilize insulator sequences to shelter the transgene from position effects and reduce expression variability

    • For structural studies requiring milligram quantities, express in HEK293S cells lacking N-acetylglucosaminyltransferase (GnTI) activity to reduce N-glycan heterogeneity

  • Protein stability during purification:
    Challenge: Maintaining structural integrity throughout extraction and purification
    Solutions:

    • Use mild detergents like n-dodecyl-β-D-maltoside (DM) for solubilization

    • Perform all procedures under dim red light or darkness to prevent unwanted photoactivation

    • Include appropriate stabilizing agents in purification buffers

    • Consider the addition of specific lipids that enhance stability

  • Functional reconstitution:
    Challenge: Achieving proper chromophore incorporation and functional activation
    Solutions:

    • Ensure high-quality 11-cis-retinal preparation (verify by absorption spectrum)

    • Optimize reconstitution conditions (pH, temperature, incubation time)

    • Verify successful reconstitution through spectroscopic analysis

    • Consider alternative chromophores (e.g., 11-cis-3-hydroxyretinal) for comparative studies

  • Mutant protein characterization:
    Challenge: Comprehensive functional analysis of multiple variants
    Solutions:

    • Develop parallel processing workflows for multiple mutants

    • Implement standardized assays for key parameters:

      • Absorption maximum (λmax)

      • Meta II decay rate

      • G protein activation efficiency

      • Photobleaching characteristics

    • Use temperature-dependent expression studies to identify conditional defects

Research has shown that these technical approaches can successfully address challenges, enabling the expression and characterization of numerous rhodopsin variants for structural and functional studies .

How can researchers verify the proper folding and functionality of recombinant Comephorus dybowskii Rhodopsin?

Multiple complementary approaches are essential for verifying proper folding and functionality of recombinant Comephorus dybowskii Rhodopsin:

  • Biochemical verification methods:

    • SDS-PAGE and Western blotting to confirm protein expression and molecular weight

    • Size exclusion chromatography to assess aggregation state

    • Limited proteolysis to probe tertiary structure (properly folded proteins show characteristic digestion patterns)

    • Glycosylation analysis to confirm proper post-translational modifications

  • Spectroscopic criteria:

    • UV-visible absorption spectrum with characteristic peak in the visible region

    • A280/Amax ratio calculation (lower ratios indicate higher proportion of properly folded protein)

    • Photobleaching upon light exposure with expected spectral shifts

    • Circular dichroism to confirm secondary structure content

  • Functional assays:

    • Chromophore binding capacity (percentage of protein able to bind 11-cis-retinal)

    • Meta II formation upon light activation

    • G protein activation efficiency compared to reference standards

    • Meta II decay rate within expected range for vertebrate rhodopsins

  • Thermal stability assessment:

    • Differential scanning calorimetry or fluorimetry to determine melting temperature

    • Temperature-dependent activity measurements

    • Accelerated stability studies at different temperatures

    • Assessment of freeze-thaw stability

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.