Recombinant Conilurus penicillatus Cytochrome c oxidase subunit 2 (MT-CO2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MT-CO2; COII; COX2; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Conilurus penicillatus (Brush-tailed rabbit-rat) (Hapalotis hemileucura)
Target Names
Target Protein Sequence
MAYPFQLGLQDATSPIMEELTNFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQE VETIWTILPAAILVLIALPSLRILYMMDEINNPVLTVKTMGHQWYWSYEYTDYEDLCFDS YMVPTNELKPGELRLLEVDNRVVLPMELPIRMLISSEDVLHSWAVPSLGLKTDAIPGRLN QATVTSNRPGLFYGQCSEICGSNHSFMPIVLEMVPLKYFESWSASMI
Uniprot No.

Target Background

Function

Cytochrome c oxidase subunit 2 (MT-CO2) is a component of cytochrome c oxidase (Complex IV), the terminal enzyme in the mitochondrial electron transport chain responsible for oxidative phosphorylation. This chain comprises three multi-subunit complexes: succinate dehydrogenase (Complex II), ubiquinol-cytochrome c oxidoreductase (Complex III), and cytochrome c oxidase (Complex IV). These complexes cooperate to transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane. This gradient drives ATP synthesis via ATP synthase. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space are transferred through the copper A center (CuA) of subunit 2 and heme A of subunit 1 to the binuclear center (BNC) in subunit 1, composed of heme A3 and copper B (CuB). The BNC reduces molecular oxygen to two water molecules using four electrons from cytochrome c and four protons from the mitochondrial matrix.

Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Conilurus penicillatus Cytochrome c oxidase subunit 2 (MT-CO2)?

Recombinant Conilurus penicillatus Cytochrome c oxidase subunit 2 (MT-CO2) is a laboratory-produced version of a natural mitochondrial protein. It represents one of the key subunits of cytochrome c oxidase (Complex IV), which serves as the terminal enzyme in the mitochondrial electron transport chain. This specific recombinant protein consists of 227 amino acids and is typically expressed in E. coli with an N-terminal His-tag for purification purposes .

MT-CO2 contains critical functional domains including two transmembrane alpha-helices and a binuclear copper A center (CuA) that serves as an electron acceptor from cytochrome c during cellular respiration . This protein plays a crucial role in the final step of mitochondrial respiration, where it contributes to the reduction of molecular oxygen to water while simultaneously pumping protons across the inner mitochondrial membrane to generate the electrochemical gradient necessary for ATP synthesis.

How is recombinant MT-CO2 expressed and purified for research applications?

The expression and purification of recombinant MT-CO2 from Conilurus penicillatus typically follows this methodological approach:

  • Expression system: The protein is expressed in E. coli with an N-terminal His-tag to facilitate purification .

  • Expression parameters:

    • Bacterial culture is grown to optimal density

    • Protein expression is induced (typically with IPTG)

    • Expression proceeds at controlled temperature and duration

    • Cells are harvested by centrifugation

  • Purification protocol:

    • Bacterial cells are lysed to release expressed protein

    • Clarified lysate is applied to nickel affinity chromatography

    • His-tagged protein is captured and washed to remove contaminants

    • Protein is eluted with imidazole-containing buffer

    • Further purification may involve size-exclusion chromatography

  • Quality control:

    • SDS-PAGE analysis confirms purity (typically >90%)

    • Western blot verifies identity

    • Protein concentration determination

    • Activity or binding assays to confirm functionality

  • Final preparation:

    • Buffer exchange to remove imidazole

    • Concentration to desired levels

    • Lyophilization for long-term storage

This process yields recombinant protein suitable for various research applications, though researchers should be aware that expression in bacterial systems may not reproduce all post-translational modifications present in the native protein.

What are the optimal storage and handling conditions for recombinant MT-CO2?

To maintain the stability and functionality of recombinant Conilurus penicillatus MT-CO2, researchers should adhere to these evidence-based storage and handling recommendations:

Storage FormTemperatureDurationAdditional Notes
Lyophilized powder-20°C to -80°CLong-termOriginal sealed container
Reconstituted (without glycerol)4°CUp to one weekWorking aliquots only
Reconstituted (with glycerol)-20°C to -80°CLong-term5-50% glycerol final concentration

Reconstitution protocol:

  • Centrifuge the vial briefly before opening to ensure all material is at the bottom

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • For long-term storage, add glycerol to a final concentration of 5-50% (50% is recommended)

  • Prepare small working aliquots to avoid repeated freeze-thaw cycles

Storage buffer composition:
The protein is typically provided in a Tris/PBS-based buffer containing 6% Trehalose at pH 8.0 , which helps maintain stability during lyophilization and storage.

How can recombinant MT-CO2 be used to study mitochondrial dysfunction and oxidative stress?

Recombinant MT-CO2 provides a valuable tool for investigating mitochondrial dysfunction and oxidative stress through several experimental approaches:

  • Functional reconstitution studies:

    • Incorporation of recombinant MT-CO2 into liposomes or nanodiscs

    • Measurement of electron transfer efficiency and oxygen consumption

    • Comparison of wild-type and mutant MT-CO2 variants to identify critical residues

  • Reactive oxygen species (ROS) production assessment:

    • Cytochrome c oxidase dysfunction is associated with increased mitochondrial ROS production

    • Wild-type versus mutant MT-CO2 comparisons can reveal how structural alterations affect electron leakage

    • In vitro systems with fluorescent ROS indicators can quantify production under varying conditions

  • Protein-protein interaction studies:

    • Investigation of MT-CO2 interactions with other respiratory complex subunits

    • Analysis of how oxidative modifications affect these interactions

    • Identification of potential regulatory proteins that interact with MT-CO2

  • Redox center characterization:

    • Spectroscopic analysis of the CuA center under normal and stressed conditions

    • Investigation of how redox state affects protein conformation and activity

    • Measurement of electron transfer kinetics using stopped-flow techniques

  • Biomarker development:

    • Use of recombinant MT-CO2 to develop assays for detecting anti-MT-CO2 antibodies in disease states

    • Standardization of assays for MT-CO2 oxidative modifications

This research is particularly relevant as cytochrome c oxidase dysfunction has been implicated in numerous pathological conditions including neurodegenerative diseases, cancer, myocardial ischemia/reperfusion, and diabetes .

What experimental approaches can be used to study the integration of MT-CO2 into functional respiratory complexes?

Investigating the integration of MT-CO2 into functional respiratory complexes requires sophisticated experimental approaches:

  • Reconstitution in membrane models:

    • Proteoliposome preparation with defined lipid composition

    • Incorporation of recombinant MT-CO2 with other cytochrome c oxidase subunits

    • Verification of complex assembly using blue native PAGE or analytical ultracentrifugation

    • Functional assessment through oxygen consumption measurements

  • Site-directed mutagenesis studies:

    • Creation of MT-CO2 variants with mutations at putative interaction sites

    • Assessment of complex assembly efficiency and stability

    • Correlation of structural changes with functional outcomes

  • Chemical crosslinking coupled with mass spectrometry:

    • Application of crosslinking agents to capture transient interactions

    • Digestion and mass spectrometric analysis to identify interaction interfaces

    • Mapping of contact points between MT-CO2 and other subunits

  • Fluorescence-based approaches:

    • Labeling of recombinant MT-CO2 with fluorescent probes

    • FRET analysis to monitor proximity to other labeled subunits

    • Real-time monitoring of assembly processes

  • Cryo-electron microscopy:

    • Structural characterization of reconstituted complexes

    • Visualization of MT-CO2 positioning within the complex

    • Identification of conformational changes associated with assembly

These approaches provide complementary information about both the structural and functional aspects of MT-CO2 integration into respiratory complexes.

How can researchers investigate post-translational modifications of MT-CO2 and their functional significance?

Post-translational modifications (PTMs) of MT-CO2 may significantly influence its function and regulation. To investigate these modifications, researchers can employ the following methodological approaches:

  • Identification of modifications:

    • High-resolution mass spectrometry of intact protein and peptide fragments

    • Enrichment strategies for specific modifications (e.g., phosphopeptide enrichment)

    • Targeted multiple reaction monitoring (MRM) for known modifications

    • Comparison of PTM patterns between native and recombinant proteins

  • Site-directed mutagenesis:

    • Mutation of modified residues to non-modifiable variants (e.g., Ser→Ala for phosphorylation)

    • Creation of phosphomimetic mutations (e.g., Ser→Asp) to simulate constitutive modification

    • Functional assessment of mutant proteins compared to wild-type

  • Modification-specific detection methods:

    • Modification-specific antibodies for western blotting or immunoprecipitation

    • Specific staining techniques (e.g., Pro-Q Diamond for phosphorylation)

    • In vitro modification assays to identify responsible enzymes

  • Structural impact assessment:

    • Hydrogen-deuterium exchange mass spectrometry to detect conformational changes

    • X-ray crystallography or cryo-EM of modified versus unmodified protein

    • Molecular dynamics simulations to predict modification effects

  • Functional consequences:

    • Activity assays comparing modified and unmodified forms

    • Protein-protein interaction studies to assess effects on complex formation

    • Cellular studies using phosphomimetic or non-phosphorylatable mutants

These approaches can reveal how PTMs regulate cytochrome c oxidase activity, potentially providing insights into disease mechanisms and therapeutic targets.

What challenges exist in expressing and purifying functionally active MT-CO2, and how can they be addressed?

Producing functionally active recombinant MT-CO2 presents several technical challenges due to its nature as a membrane protein with cofactors. These challenges and their solutions include:

ChallengeUnderlying IssueMethodological Solutions
Poor expression yieldsMembrane protein toxicity to expression hostUse specialized E. coli strains (C41/C43); lower induction temperature; optimize codon usage
Protein insolubilityHydrophobic transmembrane domainsInclude appropriate detergents (DDM, LMNG); consider fusion tags that enhance solubility
Incorrect foldingComplex topology and disulfide bondsCo-express with chaperones; add reducing/oxidizing agents to control disulfide formation
Lack of cofactor incorporationIncomplete CuA center formationSupplement expression media with copper; add copper during purification; verify incorporation spectroscopically
HeterogeneityMultiple conformational statesOptimize buffer conditions; use size exclusion chromatography to isolate homogeneous populations
Activity assessmentIsolated subunit may lack activityDevelop partial activity assays; reconstitute with other subunits; use biophysical methods to verify cofactor binding

Additional considerations include:

  • Using insect cell or mammalian expression systems for proper post-translational modifications

  • Employing membrane scaffold proteins or nanodiscs to maintain native-like environment

  • Implementing high-throughput screening to identify optimal conditions for expression and purification

  • Validating protein functionality through multiple complementary assays

What structural features of MT-CO2 are critical for electron transfer in the respiratory chain?

MT-CO2 contains several key structural elements essential for its electron transfer function in the respiratory chain:

  • The CuA center:

    • A binuclear copper center that serves as the primary electron acceptor from cytochrome c

    • Located in a conserved cysteine loop at positions 196 and 200, with a conserved histidine at position 204

    • Forms a unique electron delocalization system between the two copper atoms

    • Provides the entry point for electrons into cytochrome c oxidase

  • Transmembrane domains:

    • The N-terminal region contains two transmembrane alpha-helices

    • These helices anchor the protein in the inner mitochondrial membrane

    • Proper membrane insertion is essential for maintaining the correct orientation of the CuA domain

  • Cytochrome c binding domain:

    • Contains negatively charged residues that interact with positively charged residues on cytochrome c

    • Forms a transient electron transfer complex that positions the heme edge of cytochrome c near the CuA center

    • The binding interface must balance affinity with the need for rapid turnover

  • Internal electron transfer pathways:

    • Specific amino acid residues create electron tunneling pathways

    • Connect the CuA center to the heme a3-CuB center in MT-CO1

    • Maintain proper distances and orientations for efficient electron transfer

These structural features must work in concert to maintain the high efficiency of electron transfer required for respiratory function. Alterations in any of these elements can lead to decreased activity or increased production of reactive oxygen species .

How does the copper binding site in MT-CO2 contribute to its function, and how can it be characterized?

The copper binding site (CuA center) in MT-CO2 is fundamental to its electron transfer function and can be characterized through multiple complementary approaches:

Functional significance of the CuA center:

  • Acts as the initial electron acceptor from reduced cytochrome c

  • Contains a unique binuclear copper center with two copper atoms bridged by cysteine ligands

  • Enables rapid electron transfer due to the delocalized electronic structure

  • Maintains a redox potential optimized for accepting electrons from cytochrome c

  • Provides a pathway for electron transfer to heme a in the MT-CO1 subunit

Characterization methodologies:

TechniqueInformation ProvidedMethodological Approach
UV-visible spectroscopyRedox state and integrity of Cu centerMeasure characteristic absorption bands at ~480, 530, and 830 nm; monitor changes upon reduction/oxidation
Electron paramagnetic resonance (EPR)Electronic structure and geometryRecord spectra of the oxidized CuA center at low temperature; analyze g-values and hyperfine coupling
X-ray absorption spectroscopy (XAS)Local atomic environment of copperMeasure XANES and EXAFS to determine oxidation state and coordination geometry
Resonance Raman spectroscopyMetal-ligand vibrationsIdentify vibrational modes associated with Cu-S bonds and their response to redox changes
Potentiometric titrationsRedox potential determinationMonitor spectral changes as a function of solution potential; calculate midpoint potentials
Site-directed mutagenesisRole of specific residuesModify coordinating residues and measure effects on copper binding and electron transfer

These approaches collectively provide a comprehensive understanding of the CuA center structure and function, which is essential for interpreting how mutations or modifications might affect cytochrome c oxidase activity in health and disease.

What experimental approaches are most effective for studying the interaction between MT-CO2 and cytochrome c?

The interaction between MT-CO2 and cytochrome c is crucial for electron transfer in the respiratory chain. Several experimental approaches can effectively characterize this interaction:

  • Binding affinity measurements:

    • Surface plasmon resonance (SPR) to measure association/dissociation kinetics

    • Isothermal titration calorimetry (ITC) for thermodynamic parameters

    • Microscale thermophoresis for binding under near-native conditions

    • Fluorescence anisotropy with labeled cytochrome c to detect complex formation

  • Structural characterization:

    • X-ray crystallography of co-crystallized complexes

    • Cryo-electron microscopy of the transient complex

    • NMR chemical shift perturbation to map interaction surfaces

    • Crosslinking coupled with mass spectrometry to identify contact residues

  • Functional studies:

    • Electron transfer kinetics using stopped-flow spectroscopy

    • Oxygen consumption assays with reconstituted systems

    • Site-directed mutagenesis of putative interface residues

    • Computational simulation of electron tunneling pathways

  • In situ approaches:

    • Förster resonance energy transfer (FRET) between labeled proteins

    • Proximity ligation assays in fixed cells or tissues

    • Live-cell imaging with fluorescently tagged components

    • Chemical footprinting to identify protected regions upon binding

A systematic investigation would typically combine multiple approaches to build a comprehensive model of the interaction, from atomic-level details to functional consequences in the cellular context.

How can researchers differentiate between structural and functional effects when studying MT-CO2 mutations or modifications?

Distinguishing between structural and functional effects of MT-CO2 mutations or modifications requires a multi-faceted experimental approach:

Structural assessment methodologies:

  • Global structural integrity:

    • Circular dichroism spectroscopy to monitor secondary structure content

    • Thermal shift assays to assess protein stability

    • Size exclusion chromatography to detect aggregation or conformational changes

    • Limited proteolysis to identify altered folding or accessibility

  • Local structural changes:

    • Hydrogen-deuterium exchange mass spectrometry to map conformational dynamics

    • NMR spectroscopy for site-specific structural perturbations

    • Molecular dynamics simulations to predict structural consequences

    • Intrinsic fluorescence to monitor changes in tryptophan environment

Functional assessment methodologies:

  • Electron transfer capabilities:

    • Spectroelectrochemical measurements of redox potential

    • Stopped-flow kinetics of electron transfer from cytochrome c

    • Oxygen consumption rates in reconstituted systems

    • Superoxide production as indicator of electron leakage

  • Protein-protein interactions:

    • Binding affinity measurements with partner proteins

    • Co-immunoprecipitation or pull-down assays

    • Blue native PAGE to assess complex formation

    • Crosslinking efficiency as measure of interaction capability

Differentiation strategies:

  • Compensatory mutations: Introduce secondary mutations that restore structure but not function (or vice versa)

  • Structure-function correlation: Plot structural parameters against functional readouts to identify relationship patterns

  • Temperature dependence: Compare effects at different temperatures to distinguish thermodynamic from catalytic effects

  • Comparative analysis: Examine the same mutation in related proteins with different baseline activities

By systematically applying these approaches, researchers can determine whether observed functional changes arise from structural perturbations or direct effects on catalytic or binding properties.

What techniques can be used to study the dynamics of MT-CO2 in membrane environments?

Investigating the dynamics of MT-CO2 in membrane environments requires specialized techniques that can capture both structural and functional aspects of the protein in its native-like setting:

  • Spectroscopic approaches:

    • Site-directed spin labeling combined with electron paramagnetic resonance (EPR)

    • Fluorescence spectroscopy with environment-sensitive probes

    • Hydrogen-deuterium exchange mass spectrometry to measure solvent accessibility

    • Solid-state NMR to study protein dynamics in membrane bilayers

  • Advanced microscopy:

    • High-speed atomic force microscopy (HS-AFM) for real-time observation of conformational changes

    • Single-molecule FRET to track distance changes between labeled residues

    • Cryo-electron tomography to visualize protein in membrane context

    • Super-resolution microscopy for localization and distribution studies

  • Membrane model systems:

    • Nanodiscs with controlled lipid composition

    • Giant unilamellar vesicles (GUVs) for optical microscopy

    • Supported lipid bilayers for surface-sensitive techniques

    • Native membrane fragments enriched in respiratory complexes

  • Computational approaches:

    • Molecular dynamics simulations in explicit membrane environments

    • Coarse-grained simulations for longer timescale events

    • Elastic network models to identify collective motions

    • Quantum mechanical/molecular mechanical (QM/MM) calculations for electron transfer events

  • Functional readouts:

    • Patch-clamp electrophysiology to measure proton translocation

    • Potentiometric dyes to monitor membrane potential changes

    • Time-resolved spectroscopy to correlate structural dynamics with function

    • Microfluidic systems for rapid exchange of substrates or conditions

These techniques, often used in combination, provide insights into how MT-CO2 responds dynamically to changes in membrane environment, substrate availability, and interaction with other respiratory chain components.

How can researchers develop reliable assays to measure MT-CO2 activity in isolation and in complex systems?

Developing reliable assays for MT-CO2 activity presents challenges due to its function as part of a multisubunit complex. Here are methodological approaches for both isolated and complex system assessment:

Assays for isolated MT-CO2:

  • Redox-active site characterization:

    • UV-visible spectroscopy to monitor CuA center redox state

    • EPR spectroscopy for paramagnetic Cu(II) detection

    • Cyclic voltammetry to measure redox potential

    • Metal binding assays using colorimetric reagents or isothermal titration calorimetry

  • Electron acceptance capability:

    • Stopped-flow kinetics with reduced cytochrome c as electron donor

    • Spectrophotometric monitoring of cytochrome c oxidation at 550 nm

    • Artificial electron donors with defined redox potentials

    • Competition assays with known electron acceptors

Assays for MT-CO2 in complex systems:

  • Reconstituted complex IV assays:

    • Oxygen consumption measurements using Clark-type electrodes or optical sensors

    • Spectrophotometric assays tracking cytochrome c oxidation

    • Membrane potential generation using potential-sensitive dyes

    • Proton pumping efficiency using pH indicators

  • Cellular and mitochondrial assays:

    • Respirometry in isolated mitochondria or permeabilized cells

    • Site-specific inhibitors to isolate complex IV contribution

    • Genetic complementation in MT-CO2-deficient systems

    • Blue native PAGE with in-gel activity staining

Quality control and validation:

  • Assay standardization:

    • Use reference proteins with established activity

    • Include internal controls for each experimental batch

    • Validate with multiple orthogonal methods

    • Establish clear linearity ranges and detection limits

  • Environmental variable control:

    • Temperature control (typically 25°C or 37°C)

    • Buffer composition optimization (pH, ionic strength)

    • Defined substrate concentrations

    • Control for auto-oxidation or background activity

These methodological approaches provide a comprehensive assessment of MT-CO2 activity across different experimental contexts, from isolated protein to cellular systems.

What are the best approaches for creating and validating MT-CO2 mutants to study structure-function relationships?

Creating and validating MT-CO2 mutants requires careful experimental design and comprehensive validation to ensure meaningful structure-function analyses:

Mutant design strategies:

  • Targeted mutation approaches:

    • Alanine scanning of key functional regions

    • Conservative substitutions to maintain structure (e.g., Asp→Glu)

    • Radical substitutions to disrupt function (e.g., Cys→Ser for copper binding sites)

    • Disease-associated mutations identified in homologous proteins

    • Cross-species substitutions to identify species-specific functional elements

  • Advanced mutation strategies:

    • Incorporation of unnatural amino acids with specialized properties

    • Introduction of fluorescent amino acids as structural probes

    • Installation of photo-crosslinkable residues to capture transient interactions

    • Creation of chimeric proteins with domains from different species

    • Insertion of epitope tags at permissive sites for detection and purification

Expression and purification validation:

  • Expression level assessment:

    • Western blotting compared to wild-type protein

    • Quantitative yield determination

    • Optimization of expression conditions for each mutant

  • Structural integrity verification:

    • Circular dichroism spectroscopy for secondary structure

    • Size exclusion chromatography profiles

    • Thermal stability assays

    • Limited proteolysis resistance patterns

Functional validation approaches:

  • Biochemical characterization:

    • Metal content analysis (particularly copper)

    • Redox potential determination

    • Electron transfer kinetics

    • Protein-protein interaction assays

  • Activity measurements:

    • Cytochrome c oxidation rates

    • Oxygen consumption when reconstituted

    • ROS production assessment

    • Proton pumping efficiency

Structural correlation:

  • Experimental structure determination:

    • X-ray crystallography or cryo-EM when feasible

    • Hydrogen-deuterium exchange mass spectrometry

    • Crosslinking coupled with mass spectrometry

    • FRET-based distance measurements

  • Computational approaches:

    • Homology modeling based on related structures

    • Molecular dynamics simulations to predict mutational effects

    • Quantum mechanical calculations for electron transfer pathways

    • Prediction of stability changes (ΔΔG calculations)

By implementing these comprehensive validation strategies, researchers can ensure that observed functional changes genuinely reflect the intended structural perturbations rather than non-specific effects on protein folding or stability.

How can researchers effectively reconstitute MT-CO2 into membrane systems for functional studies?

Reconstituting MT-CO2 into membrane systems requires careful optimization to maintain protein structure and function. Here is a detailed methodological approach:

Preparation of MT-CO2 for reconstitution:

  • Protein solubilization:

    • Select detergents compatible with MT-CO2 stability (e.g., DDM, LMNG)

    • Ensure complete solubilization while minimizing detergent concentration

    • Verify protein monodispersity by dynamic light scattering

    • Consider using amphipols as detergent alternatives for enhanced stability

  • Quality control:

    • Confirm purity (>90% by SDS-PAGE)

    • Verify copper content using atomic absorption spectroscopy

    • Assess secondary structure integrity by circular dichroism

    • Measure initial activity in detergent solution

Membrane system preparation:

  • Liposome preparation:

    • Select lipid composition mimicking native mitochondrial inner membrane

    • Include cardiolipin (typically 10-20%) for optimal cytochrome c oxidase function

    • Prepare unilamellar vesicles by extrusion through defined pore sizes

    • Verify size distribution by dynamic light scattering

  • Alternative membrane mimetics:

    • Nanodiscs with MSP proteins for defined size control

    • Lipid cubic phases for structural studies

    • Supported lipid bilayers for surface-sensitive techniques

    • Polymer-based systems (e.g., SMALPs) for detergent-free extraction

Reconstitution protocols:

  • Conventional dialysis method:

    • Mix detergent-solubilized MT-CO2 with detergent-destabilized liposomes

    • Dialyze against detergent-free buffer over 24-48 hours

    • Use multiple buffer exchanges with decreasing detergent concentrations

    • Control protein:lipid ratios (typically 1:100 to 1:1000 w/w)

  • Detergent adsorption method:

    • Add Bio-Beads or Amberlite to the protein-lipid-detergent mixture

    • Control adsorption rate by temperature and bead amount

    • Monitor by light scattering to track reconstitution progress

    • Remove beads by gentle filtration

  • Direct incorporation:

    • For nanodiscs, combine MT-CO2, lipids, and scaffold protein

    • Remove detergent to trigger self-assembly

    • Purify reconstituted particles by size exclusion chromatography

Validation of reconstituted systems:

  • Structural characterization:

    • Negative-stain electron microscopy to visualize proteoliposomes

    • Freeze-fracture electron microscopy for protein distribution analysis

    • Dynamic light scattering for size distribution

    • Sucrose density gradients to separate proteoliposomes from free protein

  • Functional validation:

    • Oxygen consumption assays with reduced cytochrome c

    • Proton pumping using pH-sensitive dyes

    • Membrane potential generation with voltage-sensitive probes

    • ROS production assessment

  • Protein orientation determination:

    • Protease protection assays to determine sidedness

    • Antibody accessibility in intact vs. disrupted vesicles

    • Chemical labeling of exposed residues

These methodological details provide a comprehensive approach to MT-CO2 reconstitution, enabling functional studies in membrane environments that more closely resemble the native context.

How can recombinant MT-CO2 contribute to understanding mitochondrial diseases?

Recombinant MT-CO2 serves as a valuable tool for investigating mitochondrial diseases through multiple research applications:

  • Disease-associated variant characterization:

    • Expression of MT-CO2 variants corresponding to disease mutations

    • Biochemical comparison with wild-type protein

    • Structure-function analyses to determine pathogenic mechanisms

    • Development of high-throughput screening systems for therapeutic discovery

  • Interaction with nuclear-encoded subunits:

    • Many mitochondrial diseases involve incompatibilities between mitochondrial and nuclear genomes

    • Recombinant MT-CO2 enables controlled studies of interactions with nuclear-encoded subunits

    • In vitro assembly assays can identify specific assembly defects

    • Cross-species compatibility studies reveal evolutionary constraints

  • Oxidative stress mechanisms:

    • Cytochrome c oxidase dysfunction is associated with increased ROS production

    • Recombinant MT-CO2 variants can be tested for electron leakage propensity

    • Structure-based analyses can identify critical residues for maintaining electron transfer fidelity

    • Development of assays to measure subtle functional deficits before clinical manifestation

  • Biomarker development:

    • Recombinant MT-CO2 can serve as a standard for developing quantitative assays

    • Antibody development for detecting modified forms associated with disease

    • Protein interaction screens to identify novel binding partners relevant to disease

    • Validation of MT-CO2-derived peptides as potential biomarkers

  • Therapeutic development platforms:

    • Screening for compounds that stabilize mutant MT-CO2 function

    • Testing of artificial electron carriers to bypass defective cytochrome c oxidase

    • Development of protein replacement strategies

    • Evaluation of gene therapy approaches in cellular models

These applications demonstrate how recombinant MT-CO2 contributes to both basic understanding of disease mechanisms and translational approaches for diagnosis and therapy development.

What insights can comparative studies of MT-CO2 from different species provide for biomedical research?

Comparative studies of MT-CO2 from different species, including Conilurus penicillatus, offer valuable insights for biomedical research through evolutionary and functional perspectives:

  • Adaptive evolution insights:

    • Identification of positively selected residues that may confer functional advantages

    • Recognition of species-specific adaptations to environmental niches (e.g., hypoxia tolerance)

    • Understanding of co-evolutionary relationships between mitochondrial and nuclear genomes

    • Discovery of naturally occurring variants that confer resistance to oxidative stress

  • Structure-function conservation mapping:

    • Determination of universally conserved residues critical for enzyme function

    • Identification of variable regions that may be targets for species-specific regulation

    • Recognition of alternative structural solutions to maintain function

    • Discovery of species-specific post-translational modifications

  • Disease mechanism elucidation:

    • Comparison of human disease mutations with corresponding residues in other species

    • Identification of compensatory mechanisms in species carrying otherwise pathogenic variants

    • Recognition of species-specific vulnerabilities to toxins or environmental factors

    • Understanding of mitonuclear compatibility factors relevant to disease

  • Therapeutic development applications:

    • Discovery of naturally occurring variants with enhanced stability or function

    • Identification of species-specific regulatory mechanisms that could be therapeutic targets

    • Development of protein engineering strategies based on comparative analysis

    • Exploration of xenotransplantation possibilities for mitochondrial replacement

  • Methodological advantages:

    • Use of species with experimental advantages (e.g., genetic tractability)

    • Development of model systems using species with specific phenotypic traits

    • Creation of chimeric proteins to isolate functional domains

    • Validation of conservation-based computational predictions

These comparative approaches provide a broader evolutionary context for understanding MT-CO2 function in health and disease, potentially revealing novel therapeutic strategies based on natural adaptive solutions.

What emerging technologies are advancing our understanding of MT-CO2 structure and function?

Several cutting-edge technologies are revolutionizing MT-CO2 research, providing unprecedented insights into its structure, dynamics, and function:

  • Advanced structural biology techniques:

    • Cryo-electron microscopy at near-atomic resolution for complete cytochrome c oxidase complexes

    • Micro-electron diffraction (MicroED) for structural determination from nanocrystals

    • Integrative structural biology combining multiple experimental data sources

    • Time-resolved X-ray crystallography to capture conformational changes

  • Single-molecule approaches:

    • Single-molecule FRET to track conformational dynamics in real-time

    • Optical tweezers to study mechanical properties and folding

    • Nanopore technologies for single-molecule protein analysis

    • High-speed AFM for direct visualization of conformational changes

  • Advanced spectroscopy:

    • Ultrafast time-resolved spectroscopy to capture electron transfer events

    • Two-dimensional electronic spectroscopy for energy transfer pathways

    • Advanced EPR techniques (ENDOR, ESEEM) for detailed analysis of metal centers

    • Quantum coherence measurements to investigate quantum effects in electron transfer

  • Genetic and genome editing technologies:

    • CRISPR-based mitochondrial genome editing

    • Site-specific introduction of unnatural amino acids

    • In vivo mutagenesis with high-throughput phenotyping

    • Barcoded mutant libraries for massively parallel functional assays

  • Computational approaches:

    • AI-based protein structure prediction and design

    • Quantum mechanical simulations of electron transfer processes

    • Multiscale modeling from atomic to cellular levels

    • Machine learning for pattern recognition in large-scale functional data

  • Advanced imaging technologies:

    • Super-resolution microscopy of respiratory complexes in situ

    • Correlative light and electron microscopy for structure-function studies

    • Label-free imaging based on intrinsic contrast mechanisms

    • Volumetric imaging of mitochondrial networks and respiratory complex distribution

These technologies collectively enable researchers to address previously intractable questions about MT-CO2 function, from quantum-level electron transfer events to system-level integration in cellular metabolism.

What are the key unresolved questions about MT-CO2 that warrant further investigation?

Despite significant advances in our understanding of cytochrome c oxidase biology, several critical questions about MT-CO2 remain unresolved and merit further investigation:

  • Regulatory mechanisms:

    • How is MT-CO2 activity regulated by post-translational modifications?

    • What are the species-specific regulatory mechanisms that tune activity to metabolic demands?

    • How do interactions with nuclear-encoded subunits modulate MT-CO2 function?

    • What is the role of MT-CO2 in respiratory supercomplex assembly and stability?

  • Electron transfer dynamics:

    • What are the precise electron tunneling pathways through MT-CO2?

    • How do conformational dynamics influence electron transfer efficiency?

    • What determines the balance between productive electron transfer and electron leakage?

    • How do lipid-protein interactions modulate electron transfer properties?

  • Evolutionary aspects:

    • Why has MT-CO2 remained encoded by mitochondrial DNA throughout eukaryotic evolution?

    • What functional constraints have maintained the basic structure of MT-CO2 across diverse species?

    • How have species-specific adaptations modified MT-CO2 function for different metabolic requirements?

    • What co-evolutionary mechanisms ensure compatibility between mitochondrial and nuclear genomes?

  • Pathological implications:

    • How do specific mutations in MT-CO2 contribute to mitochondrial disease phenotypes?

    • What role does MT-CO2 dysfunction play in neurodegenerative diseases and aging?

    • How does oxidative damage to MT-CO2 contribute to mitochondrial dysfunction?

    • Can MT-CO2 serve as a therapeutic target for mitochondrial diseases?

  • Methodological frontiers:

    • How can we better model the membrane environment for functional studies?

    • What approaches can capture transient conformational states during catalysis?

    • How can we manipulate MT-CO2 function in vivo with spatial and temporal precision?

    • What biomarkers could reflect MT-CO2 dysfunction in clinical samples?

Addressing these questions will require interdisciplinary approaches combining structural biology, biophysics, genetics, and systems biology, potentially leading to new therapeutic strategies for mitochondrial disorders.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.