Recombinant Conocephalum conicum Photosystem Q (B) protein (psbA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery estimates, please consult your local distributor.
Note: All protein shipments are standardly accompanied by normal blue ice packs. If dry ice packaging is required, please inform us in advance. Additional charges will apply.
Notes
Repeated freezing and thawing is discouraged. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to concentrate the contents. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. The shelf life for lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
psbA; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-344
Protein Length
full length protein
Species
Conocephalum conicum (Liverwort)
Target Names
psbA
Target Protein Sequence
MTATLERRESASIWGRFCNWVTSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDI DGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYEIIVLHFL LGVACYMGREWELSYRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTF NFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANAGYKFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGF NFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase. It harnesses light energy to extract electrons from H2O, generating O2 and a proton gradient that drives ATP formation. PSII comprises a core antenna complex responsible for capturing photons and an electron transfer chain that converts light energy into charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, along with subsequent electron acceptors.
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the role of psbA protein in photosynthetic electron transport?

The psbA gene encodes the D1 protein, a core component of Photosystem II (PSII) that is crucial for the electron transport process during photosynthesis. This protein binds cofactors necessary for electron transfer from water to plastoquinone, containing the reaction center P680 and binding sites for electron acceptors including pheophytin and quinone (QB). The full-length Conocephalum conicum psbA protein consists of 344 amino acids and functions within the thylakoid membrane environment . Research indicates that psbA is involved in regulating photosynthetic efficiency, particularly under stress conditions, and undergoes rapid turnover as part of the PSII repair cycle .

How does the amino acid sequence influence structural characteristics of psbA?

The amino acid sequence of C. conicum psbA protein (344 amino acids) contains regions that form multiple transmembrane helices anchoring the protein within the thylakoid membrane. The sequence (MTATLERRESASIWGRFCNWVTSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDIDGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYEIIVLHFLLGVACYMGREWELSYRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTFNFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANAGYKFGQEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGFNFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA) includes specific domains responsible for cofactor binding (chlorophylls, pheophytin, plastoquinone, and manganese cluster) . These structural elements are critical for the protein's function in electron transport and its interactions with other PSII components.

What experimental techniques are most effective for analyzing psbA protein conformation?

Multiple biophysical techniques can be employed to analyze psbA protein conformation:

  • Spectroscopic techniques: Circular dichroism (CD) provides information about secondary structure content, while fluorescence spectroscopy reveals cofactor binding and protein folding characteristics.

  • Structural biology approaches: X-ray crystallography and cryo-electron microscopy provide high-resolution structural information, though these require optimization for membrane proteins like psbA.

  • Thermoluminescence and delayed fluorescence measurements: These techniques have been effectively used to study functional differences between PsbA variants by detecting shifts in redox potentials and energy relationships between electron transfer components .

  • Blue Native/SDS-PAGE: This technique allows examination of how psbA incorporates into larger protein complexes and can be used to assess structural integrity in different conditions .

What expression systems yield functionally active recombinant psbA protein?

  • Strain selection: BL21(DE3) or specialized strains like C41/C43(DE3) that better tolerate membrane protein expression.

  • Expression conditions: Lower temperatures (16-20°C) and reduced inducer concentrations typically improve proper folding of membrane proteins.

  • Vector design: Using vectors with tunable promoters allows controlled expression rates.

  • Codon optimization: Adapting codons to match E. coli preference can enhance expression levels.

For functional studies, alternative systems like cell-free protein synthesis might be advantageous as they allow direct incorporation into liposomes or nanodiscs, potentially improving proper folding.

What purification challenges are specific to psbA protein, and how can they be addressed?

Purification of recombinant psbA presents several challenges due to its membrane protein nature:

  • Membrane extraction: Effective solubilization requires careful detergent selection. n-dodecyl-β-D-maltoside has been successfully used for thylakoid membrane protein solubilization .

  • Maintaining stability: The addition of stabilizing agents like trehalose (6%) in Tris/PBS-based buffer at pH 8.0 helps maintain protein integrity during purification .

  • Affinity purification: His-tagged psbA can be purified using immobilized metal affinity chromatography (IMAC), but care must be taken to include appropriate detergents in all buffers.

  • Storage considerations: As recommended in the product specification, adding glycerol (30-50%) for frozen storage and avoiding repeated freeze-thaw cycles is crucial .

  • Protein aggregation: Size exclusion chromatography serves as an important polishing step to remove aggregates and achieve higher purity.

How can researchers verify the functional integrity of purified recombinant psbA?

Multiple complementary approaches can assess functional integrity:

  • Spectroscopic analysis: Characteristic absorption and fluorescence spectra can confirm proper folding and cofactor binding.

  • Electron transfer measurements: Techniques like thermoluminescence and delayed fluorescence can detect proper energetics of electron transfer components, as demonstrated in studies of different PsbA variants .

  • Ligand binding assays: Measuring binding of known ligands (herbicides, quinones) can verify structural integrity of binding sites.

  • Reconstitution experiments: Incorporating purified psbA into liposomes or nanodiscs and assessing electron transfer capability can confirm functionality.

  • Structure-based validation: Comparing secondary structure content (via CD spectroscopy) with predicted values based on the known structure of D1 protein.

How can recombinant psbA be used to investigate photoinhibition mechanisms?

Recombinant psbA provides valuable tools for studying photoinhibition mechanisms:

  • Comparative studies with variants: Expressing wild-type and mutant versions allows investigation of specific residues involved in photodamage susceptibility. Research has shown that different psbA variants (e.g., PsbA3 vs. PsbA1) have different photoprotection properties .

  • Controlled light exposure experiments: Exposing purified protein to defined light intensities and measuring damage patterns can identify vulnerable regions and protective mechanisms.

  • Site-directed mutagenesis: Creating specific mutations to test hypotheses about residues involved in photoinhibition resistance or repair processes.

  • Redox potential manipulation: Engineering variants with altered redox properties to understand how shifts in cofactor redox potentials (like pheophytin) affect photoprotection, as observed in natural psbA variants .

  • Protein turnover studies: Using tagged recombinant psbA to track degradation and replacement rates during high light exposure.

What methodological approaches reveal how environmental stressors affect psbA function?

Several methodological approaches can be employed:

  • Comparative stress response analysis: Exposing recombinant psbA to controlled stress conditions (high light, temperature extremes, salinity) and quantifying damage using spectroscopic methods or immunoblotting.

  • Proteomic approaches: Blue native/SDS-PAGE analysis can reveal how stress affects protein complex formation and stability, as demonstrated in salt stress studies .

  • Stress-induced modifications: Mass spectrometry can identify post-translational modifications that occur under stress conditions.

  • Transcript-protein correlation studies: Analyzing both transcript and protein levels during stress can reveal regulatory mechanisms at transcriptional and translational levels .

  • Protective compound screening: Testing compounds like putrescine (shown to protect against salt stress ) for their effects on psbA stability and function under stress conditions.

How can different psbA variants be distinguished in experimental systems?

Distinguishing between psbA variants presents challenges due to high sequence similarity. Effective approaches include:

  • Mass spectrometry-based methods: RP-LC-ESI-MS/MS has been successfully employed to quantify different PsbA proteins despite their high sequence similarity .

  • Isoform-specific antibodies: Developing antibodies against unique epitopes can distinguish variants in immunoblotting.

  • Genetic approaches: Creating knockout mutants (ΔpsbA1/psbA2, ΔpsbA3) allows isolation and characterization of specific variants, as demonstrated in research with Thermosynechococcus elongatus .

  • Functional fingerprinting: Different variants may show characteristic patterns in thermoluminescence and delayed fluorescence measurements that can serve as identifiers .

  • RT-qPCR: At the transcript level, carefully designed primers can distinguish between highly similar psbA gene variants .

What strategies can address discrepancies between psbA transcript and protein levels?

Discrepancies between transcript and protein levels are common with psbA and require specific approaches:

  • Comprehensive quantification: Employ RT-qPCR for transcripts and mass spectrometry (RP-LC-ESI-MS/MS) for proteins to accurately quantify both .

  • Time-course experiments: Monitor both transcript and protein levels at multiple time points after environmental changes to account for temporal delays between transcription and translation.

  • Protein turnover assessment: Measure synthesis and degradation rates simultaneously using pulse-chase experiments to understand if high turnover contributes to discrepancies.

  • Translation efficiency analysis: Investigate factors affecting psbA translation, such as RNA secondary structure or RNA-binding proteins.

  • Stress-specific patterns: Different stresses may affect the transcript-protein correlation differently, as seen in high light and salt stress studies .

Research has demonstrated that under high light conditions, PsbA3 protein levels closely corresponded to transcript levels (~70%), while PsbA2 transcripts produced no detectable protein, highlighting the importance of post-transcriptional regulation .

How can redox potential changes in psbA variants be measured and interpreted?

Several complementary approaches can measure redox potential changes:

  • Thermoluminescence measurements: This technique detects shifts in the free energy between redox pairs in different psbA variants by measuring light emission during controlled warming after illumination .

  • Delayed fluorescence measurements: Analyzing emission kinetics after charge recombination events provides information about the energetics of electron transfer .

  • Spectroelectrochemical titrations: Direct measurement of redox potentials can be achieved by monitoring spectral changes while systematically varying the electrochemical potential.

  • Flash-induced absorbance or fluorescence changes: These techniques can provide kinetic information about electron transfer events between cofactors.

  • EPR spectroscopy: This can detect and characterize paramagnetic species formed during electron transfer, providing information about the electronic structure of redox-active cofactors.

Research has shown that PsbA3 complexes exhibit a shift in the redox potential of pheophytin toward more positive values compared to PsbA1, resulting in better protection against photoinhibition due to more efficient harmless dissipation of excess energy .

What controls are essential when comparing different psbA variants in functional studies?

When comparing psbA variants, several controls are essential:

  • Genetic background controls: Use isogenic strains differing only in the psbA gene to minimize other variables.

  • Expression level normalization: Ensure comparable expression levels of different variants to avoid confounding effects of protein abundance.

  • Functional system controls: When studying isolated proteins, consistent reconstitution into liposomes or nanodiscs of defined composition is crucial.

  • Wild-type references: Include wild-type psbA as a reference point for comparing mutant or variant performance.

  • Environmental condition standardization: Maintain identical growth and experimental conditions when comparing variants.

  • Knockout controls: As demonstrated in research, creating knockout mutants (e.g., ΔpsbA1/psbA2, ΔpsbA3) allows definitive attribution of observed phenotypes to specific protein variants .

  • Measurement technique controls: Include internal standards for quantitative techniques and technical replicates to ensure measurement reliability.

What are the most frequent issues in recombinant psbA expression and how can they be resolved?

Common challenges and solutions include:

  • Protein aggregation and misfolding:

    • Reduce expression temperature (16-20°C) and inducer concentration

    • Use specialized E. coli strains designed for membrane proteins

    • Add membrane-mimetic compounds to the culture medium

    • Consider fusion partners that enhance solubility

  • Low expression yields:

    • Optimize codon usage for the expression host

    • Use strong, controllable promoters

    • Consider cell-free expression systems

    • Scale up culture volumes to compensate for low per-cell yield

  • Cofactor incorporation:

    • Supplement growth media with cofactor precursors

    • Perform in vitro reconstitution with purified cofactors

    • Consider expression in chlorophyll-producing organisms

  • Protein instability:

    • Include stabilizing agents (glycerol, trehalose as used in the product specification )

    • Minimize purification steps and time

    • Maintain low temperature throughout purification

What analytical challenges arise when studying psbA in complex photosynthetic systems?

Several analytical challenges must be addressed:

  • Distinguishing psbA variants: Mass spectrometry-based approaches like RP-LC-ESI-MS/MS have been developed to distinguish and quantify highly similar psbA variants that could not be differentiated by other methods .

  • Complex formation analysis: Blue Native/SDS-PAGE can effectively separate and identify photosystem complexes containing psbA, as demonstrated in studies of salt stress effects on thylakoid membranes .

  • Protein-protein interaction mapping: Identifying interactions between psbA and other photosystem components requires techniques like cross-linking coupled with mass spectrometry or co-immunoprecipitation.

  • Turnover rate measurement: The high turnover rate of psbA complicates steady-state analysis and requires pulse-chase or similar kinetic approaches.

  • Environmental effects differentiation: Separating direct effects on psbA from indirect effects mediated through other proteins or signaling pathways requires carefully designed control experiments.

What method development strategies can advance psbA research beyond current limitations?

Several methodological advances could significantly enhance psbA research:

  • Single-molecule techniques: Developing approaches to study individual psbA molecules could reveal heterogeneity masked in bulk measurements.

  • In situ structural analysis: Improving techniques for structural determination of proteins within their native membrane environment would provide more physiologically relevant information.

  • Real-time monitoring systems: Designing reporter systems for tracking psbA turnover and modification in real-time would enhance understanding of dynamic responses.

  • High-throughput mutagenesis: Implementing systems for rapid creation and screening of psbA variants could accelerate structure-function studies.

  • Computational prediction improvement: Enhancing algorithms for predicting how sequence variations affect electron transfer properties would guide experimental design.

  • Standardized reconstitution systems: Developing defined minimal systems for functional reconstitution would allow more precise mechanistic studies.

  • psbA-specific labeling techniques: Creating methods for selective labeling of psbA in complex systems would enable tracking of this specific protein among many similar proteins.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.