Recombinant Conocephalum supradecompositum Photosystem Q (B) protein (psbA)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant psbA

The recombinant Conocephalum supradecompositum Photosystem Q(B) protein (psbA) is a plant-derived version of the D1 subunit in Photosystem II (PSII). This protein is critical for light-dependent electron transport, oxygen evolution, and photoprotection in photosynthetic organisms. The recombinant form is engineered for structural and functional studies, leveraging E. coli expression systems and His-tag purification .

Regulation in Light Responses

  • Light-Induced Expression: In cyanobacteria, psbA transcription increases under high light via sigma factors (e.g., SigB, SigD) .

  • Post-Transcriptional Control: Antisense RNAs (asRNAs) stabilize psbA mRNA, enhancing D1 synthesis .

Expression, Purification, and Stability

Production Workflow

  1. Cloning: Full-length psbA inserted into bacterial expression vectors.

  2. Expression: Induced in E. coli under optimized conditions (e.g., temperature, IPTG concentration) .

  3. Purification: His-tag affinity chromatography followed by lyophilization .

Stability and Handling

ParameterDetailSource
Storage-20°C/-80°C; avoid freeze-thaw cycles
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL); optional glycerol (5–50%)

The recombinant protein’s stability is critical for structural studies (e.g., X-ray crystallography) and functional assays .

Research Applications and Future Directions

Experimental Uses

  1. Structural Biology: Crystallization to resolve TMH interactions or cofactor binding .

  2. Biochemical Assays:

    • Electron Transfer Activity: Measure oxygen evolution rates or redox potentials.

    • Photodegradation Studies: Assess turnover rates under UV/high-light stress .

  3. Antibody Production: As an antigen for generating D1-specific antibodies .

Unresolved Questions

  • Plant-Specific Mechanisms: How does the liverwort D1 protein differ from cyanobacterial isoforms in photoprotection?

  • Environmental Adaptation: Role of Conocephalum supradecompositum psbA in terrestrial vs. aquatic habitats.

Comparative Analysis with Cyanobacterial psbA

FeatureCyanobacterial psbA (e.g., Synechococcus)Conocephalum supradecompositum psbA
Gene Family2–3 psbA genes (isoforms D1:1/D1:2)Single psbA gene
Light RegulationStrong transcriptional control Limited data; inferred from homologs
C-Terminal ProcessingCtpA-dependent cleavage Potential differences in protease sites
StabilityRapid mRNA turnover under stress Unknown; requires experimental validation

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery information.
Note: Our proteins are typically shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional charges will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is defined during production. If you have a specific tag type preference, please inform us. We will prioritize developing the specified tag if possible.
Synonyms
psbA; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-344
Protein Length
full length protein
Species
Conocephalum supradecompositum (Liverwort)
Target Names
psbA
Target Protein Sequence
MTATLERRESASIWGRFCNWVTSTETRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDI DGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFL LGVACYMGREWELSYRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTF NFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANAGYKFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGF NFNQSVVDSQGRVINTWADIINRANPGMEVMHERNAHNFPPNLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase that utilizes light energy to extract electrons from H2O, generating O2 and a proton gradient. This gradient is subsequently used for ATP formation. PSII comprises a core antenna complex responsible for capturing photons and an electron transfer chain that converts photonic excitation into charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, along with several subsequent electron acceptors.
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Photosystem Q(B) protein (psbA) and what is its functional significance in bryophytes?

Photosystem Q(B) protein, also known as psbA or D1 protein, is a crucial component of Photosystem II in photosynthetic organisms including liverworts like Conocephalum conicum. This protein forms the reaction center of PSII and binds the electron acceptor quinone B (Q(B)), playing an essential role in the electron transport chain during photosynthesis. In bryophytes, this protein maintains the fundamental photosynthetic function found across green plants while exhibiting sequence variations that reflect evolutionary adaptations specific to liverworts .

The protein consists of 344 amino acids in Conocephalum conicum and contains several transmembrane domains that anchor it within the thylakoid membrane. Its function is critical for light harvesting and energy conversion processes, making it an important subject for studying photosynthetic evolution in early land plants .

How should recombinant Conocephalum conicum psbA protein be stored and handled?

For optimal stability and experimental reproducibility, recombinant Conocephalum conicum psbA protein should be stored at -20°C or -80°C upon receipt. The protein is typically supplied as a lyophilized powder in a Tris/PBS-based buffer with 6% trehalose at pH 8.0 .

For working solutions, the following protocol is recommended:

  • Briefly centrifuge the vial before opening to bring contents to the bottom

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (the standard recommendation is 50%)

  • Aliquot the solution to minimize freeze-thaw cycles

  • Store working aliquots at 4°C for up to one week

  • For long-term storage, keep aliquots at -20°C or -80°C

Repeated freeze-thaw cycles should be avoided as they can compromise protein integrity and activity .

How has psbA gene sequencing contributed to understanding phylogenetic relationships in Conocephalum conicum?

The psbA gene has proven to be a valuable molecular marker for resolving phylogenetic relationships among Conocephalum conicum taxa. Research by Kim et al. revealed significant molecular differentiation within what was previously considered a single morphological species .

Key findings from psbA sequencing studies include:

  • Pairwise differences in nucleotide sequences between Conocephalum conicum samples vary considerably, ranging from 0.001 to 0.018 per site, indicating substantial genetic diversity within this morphological species .

  • Seven amino acid substitutions were identified among all samples examined, suggesting functional adaptation in different lineages .

  • Phylogenetic analysis using both Neighbor-Joining and parsimony methods provided the first molecular phylogenetic trees for this species complex, confirming relationships previously inferred from isozyme and morphological studies .

  • The psbA sequence data revealed that some morphologically distinct taxa likely represent the same species. For example, the FS and T taxa from Japan showed identical psbA sequences, suggesting they are conspecific despite morphological differences .

  • Chemical variation (different "chemo-types" with distinct volatile compound profiles) correlated with genetic differentiation in the psbA gene, with chemo-types I and II clustering with "cryptic species" J, while chemo-type III was genetically distinct from all other taxa .

These findings strongly support that Conocephalum conicum represents a complex of cryptic species that are highly differentiated at the molecular level, with the psbA gene providing a reliable marker for resolving these relationships .

What methodological considerations are important when expressing plant photosystem proteins in E. coli?

Expressing functional plant photosystem proteins like psbA in E. coli presents several challenges that researchers must address:

  • Codon optimization: Plant and bacterial codon usage differs significantly. For successful expression of Conocephalum conicum psbA, codon optimization for E. coli is essential to avoid translational pausing and premature termination .

  • Membrane protein expression: As an integral membrane protein, psbA contains hydrophobic domains that can cause toxicity to E. coli and lead to inclusion body formation. Expression strategies may include:

    • Using specialized E. coli strains (e.g., C41, C43) designed for membrane protein expression

    • Employing lower induction temperatures (16-20°C)

    • Modulating expression rates with weaker promoters or lower inducer concentrations

  • Folding and stability: Recombinant psbA often requires stabilization. The addition of 6% trehalose in the buffer formulation helps maintain protein stability during lyophilization and storage .

  • Purification strategy: The addition of an N-terminal His-tag facilitates purification via affinity chromatography without interfering with the C-terminal regions critical for protein function .

  • Reconstitution requirements: For functional studies, the protein often needs to be reconstituted in a lipid environment that mimics the thylakoid membrane. Detergents like n-dodecyl β-D-maltoside (DDM) or lipid nanodiscs may be required to maintain proper folding.

When properly expressed and purified, recombinant psbA from E. coli can serve as a valuable tool for structural studies, antibody production, and protein-protein interaction analyses .

How can sequence variations in psbA be applied to taxonomic classification of cryptic Conocephalum species?

The psbA gene sequence provides valuable molecular data for resolving taxonomic ambiguities within the Conocephalum conicum complex, which contains multiple cryptic species. Researchers can apply psbA sequence variation in the following ways:

  • Developing molecular markers: Specific regions of the psbA gene showing consistent variation between taxa can be used to develop PCR-based markers for rapid identification of cryptic species without full sequencing .

  • Correlation with other data: psbA sequence data can be integrated with morphological characteristics, isozyme patterns, and chemotype analyses for a comprehensive taxonomic framework. For example:

    • Species FS and taxon T were confirmed to be conspecific through identical psbA sequences

    • YFS and KYT taxa cluster with FS cryptic species

    • Chemo-types I and II cluster with cryptic species J

  • Quantitative differentiation: The degree of sequence divergence (0.001-0.018 substitutions per site) provides a quantitative measure for establishing taxonomic boundaries. Taxa with divergence values above a certain threshold may represent distinct species .

  • Amino acid substitution analysis: Seven amino acid substitutions were found among all samples, and the pattern of these substitutions can inform phylogenetic relationships and potentially correlate with functional adaptations to different environments .

  • Biogeographical studies: psbA sequence variation can help trace the evolutionary history and geographical distribution patterns of different Conocephalum lineages, contributing to our understanding of bryophyte speciation processes.

This molecular approach has revealed that what was traditionally considered a single morphological species (Conocephalum conicum) is actually a complex of distinct genetic entities that may warrant recognition as separate species .

What are the recommended procedures for functional assays of recombinant psbA protein?

To assess the functional properties of recombinant Conocephalum conicum psbA protein, researchers can employ several complementary approaches:

  • Electron transport measurements:

    • Oxygen evolution assays using artificial electron acceptors like dichlorophenolindophenol (DCPIP)

    • Hill reaction measurements to assess electron transport capacity

    • Polarographic methods using Clark-type electrodes to measure oxygen evolution rates

  • Binding assays for herbicides and quinones:

    • Competitive binding assays with labeled herbicides (e.g., 14C-atrazine) to assess Q(B) binding site functionality

    • Isothermal titration calorimetry (ITC) to determine binding affinities for various quinones

    • Surface plasmon resonance (SPR) measurements for real-time binding kinetics

  • Reconstitution into liposomes:

    • Incorporation of purified psbA into liposomes containing other PSII components

    • Assessment of partial reactions in the reconstituted system

    • Measurement of proton pumping across the liposome membrane

  • Spectroscopic analysis:

    • Circular dichroism (CD) to assess secondary structure integrity

    • Fluorescence spectroscopy to monitor protein folding and cofactor binding

    • EPR spectroscopy to examine radical formation during electron transport

For all functional assays, it is crucial to reconstitute the lyophilized protein properly according to the manufacturer's recommendations, typically in a buffer containing 50% glycerol for stability . The recombinant protein must be maintained in an appropriate membrane-mimetic environment using detergents or lipid systems to preserve its native structure and function.

How can psbA sequence data be used to study evolutionary adaptation in bryophytes?

The psbA gene offers a powerful tool for investigating evolutionary adaptation in bryophytes, particularly in the Conocephalum conicum complex. Researchers can apply the following approaches:

The discovery of seven amino acid substitutions among Conocephalum conicum taxa provides an excellent starting point for investigating how natural selection has shaped photosynthetic function in these ancient land plants. These substitutions may reflect adaptations to specific microhabitats and could explain the ecological differentiation observed among cryptic species in this complex.

What techniques are most effective for studying protein-protein interactions involving psbA in photosynthetic complexes?

Studying protein-protein interactions of the psbA (D1) protein within photosynthetic complexes requires specialized techniques that accommodate its membrane-bound nature. The following methods are particularly effective:

  • Crosslinking approaches:

    • Chemical crosslinking using agents like glutaraldehyde or EDC to capture transient interactions

    • Photo-crosslinking with UV-activatable amino acid analogs incorporated at specific positions

    • Analysis of crosslinked products by mass spectrometry to identify interaction partners and contact points

  • Co-immunoprecipitation with modifications for membrane proteins:

    • Solubilization with mild detergents (e.g., digitonin, n-dodecyl β-D-maltoside)

    • Pull-down assays using anti-His antibodies to capture the tagged recombinant psbA

    • Identification of co-precipitated proteins by mass spectrometry

  • Förster Resonance Energy Transfer (FRET):

    • Labeling of psbA and potential interaction partners with appropriate fluorophore pairs

    • Measurement of energy transfer as evidence of protein proximity

    • Live-cell FRET measurements in transformed systems to study dynamic interactions

  • Split-reporter assays modified for membrane proteins:

    • Split-GFP, split-luciferase, or split-ubiquitin systems optimized for membrane proteins

    • Bimolecular Fluorescence Complementation (BiFC) to visualize interactions in cellular contexts

    • Monitoring reporter activity as an indicator of protein-protein association

  • Surface Plasmon Resonance (SPR) with nanodiscs:

    • Incorporation of psbA into nanodiscs to maintain native membrane environment

    • Immobilization on SPR chips via the His-tag

    • Real-time monitoring of interaction kinetics with other photosystem components

  • Cryo-electron microscopy:

    • Single-particle analysis of isolated PSII complexes containing recombinant psbA

    • Structural determination of protein-protein interfaces at near-atomic resolution

    • Comparison of structures with and without specific binding partners

When working with recombinant Conocephalum conicum psbA protein for interaction studies, researchers should ensure proper folding through reconstitution in appropriate membrane-mimetic systems before performing interaction analyses .

What are common challenges in working with recombinant photosystem proteins and their solutions?

Researchers working with recombinant photosystem proteins like psbA from Conocephalum conicum face several challenges that require specific troubleshooting approaches:

ChallengeCauseSolution
Low protein solubilityHydrophobic transmembrane domainsUse appropriate detergents (DDM, OG); consider fusion tags that enhance solubility; reconstitute in nanodiscs or liposomes
Loss of activity during storageProtein denaturation, oxidationStore with 50% glycerol ; add reducing agents; aliquot to avoid freeze-thaw cycles; store at -80°C for long-term preservation
Aggregation after reconstitutionImproper folding, concentration too highReconstitute at lower concentrations (0.1-0.5 mg/mL); add stabilizing agents like trehalose ; optimize detergent:protein ratio
Inconsistent functional assaysCofactor loss, improper reconstitutionSupplement with required cofactors (chlorophyll, quinones); ensure complete solubilization; control temperature during assays
Degradation during experimentsProtease contamination, instabilityAdd protease inhibitors; work at 4°C; minimize exposure to light and oxidizing conditions
Poor binding in interaction studiesNon-native conformationVerify protein folding by circular dichroism; optimize membrane mimetic environment; ensure proper orientation in binding assays

Additionally, researchers should be aware that recombinant psbA may lack post-translational modifications present in the native protein, potentially affecting certain interactions or functional properties. When possible, comparing results with native protein preparations can help validate findings with the recombinant version .

How can researchers optimize psbA gene sequencing for phylogenetic studies in bryophytes?

Optimizing psbA gene sequencing for phylogenetic studies in bryophytes like Conocephalum conicum requires attention to several methodological aspects:

  • Sample collection and preservation:

    • Collect fresh material whenever possible to obtain high-quality DNA

    • For field collections, use silica gel desiccation or rapid freezing in liquid nitrogen

    • Document precise collection locations and microhabitat characteristics for correlation with genetic data

  • DNA extraction optimization:

    • Use extraction protocols designed for plants with high polysaccharide and polyphenol content

    • Include PVPP (polyvinylpolypyrrolidone) in extraction buffers to remove phenolic compounds

    • Consider commercial kits specifically designed for plant material with difficult compounds

  • PCR amplification strategies:

    • Design bryophyte-specific primers based on conserved regions of the psbA gene

    • Use touchdown PCR protocols to improve specificity

    • Include additives like DMSO or betaine to deal with high GC content regions

  • Sequencing considerations:

    • Sequence both strands for verification

    • Use internal primers for long fragments to ensure complete coverage

    • Consider next-generation sequencing for population-level studies with many samples

  • Data analysis optimization:

    • Align sequences using algorithms suitable for coding regions

    • Test multiple evolutionary models to find the best fit for psbA sequence data

    • Use appropriate outgroups from related liverwort taxa

    • Employ both distance-based and character-based phylogenetic methods for comparison, as done in previous studies

  • Integrative approach:

    • Combine psbA data with other genomic regions (e.g., rbcL, trnL-F) for more robust phylogenies

    • Correlate molecular findings with morphological, chemical, and ecological data

    • Consider population-level sampling to capture the full range of genetic diversity

This optimized approach has proven effective in previous studies, revealing significant molecular differentiation within Conocephalum conicum and supporting the existence of multiple cryptic species within this morphological complex .

What emerging technologies might advance our understanding of psbA function and evolution?

Several cutting-edge technologies are poised to transform research on psbA function and evolution in bryophytes like Conocephalum conicum:

  • CRISPR-Cas9 genome editing in bryophytes:

    • Introduction of specific amino acid substitutions to test functional hypotheses

    • Creation of knockout/knockdown lines to assess psbA essentiality and compensation mechanisms

    • Development of reporter fusions for in vivo localization and dynamics studies

  • Single-molecule techniques:

    • Single-molecule FRET to study conformational changes during electron transport

    • Optical tweezers combined with fluorescence to examine mechanical properties of protein complexes

    • Super-resolution microscopy to visualize PSII complexes in thylakoid membranes

  • Cryo-electron tomography:

    • Visualization of PSII-LHCII supercomplexes in native thylakoid membranes

    • Structural determination of species-specific arrangements in Conocephalum

    • Comparison of structural organization across cryptic species with different psbA sequences

  • Comparative genomics and transcriptomics:

    • Whole-genome sequencing of multiple Conocephalum taxa to place psbA evolution in genomic context

    • Transcriptome analysis across environmental gradients to identify co-expressed genes

    • Identification of regulatory elements controlling psbA expression in different taxa

  • Protein design and synthetic biology:

    • Creation of chimeric psbA proteins with domains from different species to test functional hypotheses

    • Engineering of psbA variants with enhanced photosynthetic efficiency or stress tolerance

    • Development of minimal synthetic photosystems incorporating optimized psbA proteins

  • Environmental metagenomics:

    • Sequencing of psbA from unculturable or rare bryophyte species in diverse ecosystems

    • Analysis of population-level variation in natural habitats

    • Correlation of sequence variants with microclimate parameters

These technologies will help resolve outstanding questions about how the seven amino acid substitutions identified in Conocephalum conicum psbA affect protein function and how photosynthetic adaptations have contributed to speciation in this bryophyte complex .

How might research on bryophyte photosystem proteins contribute to applied biotechnology?

Research on bryophyte photosystem proteins, particularly psbA from Conocephalum conicum, has several promising biotechnological applications:

  • Stress-resistant crop development:

    • Identification of amino acid substitutions that confer resistance to photoinhibition

    • Transfer of beneficial bryophyte psbA variants to crops via genetic engineering

    • Development of screening tools based on psbA sequence motifs associated with stress tolerance

  • Bioproduction platforms:

    • Optimization of photosynthetic efficiency in microalgae by incorporating bryophyte psbA variants

    • Engineering of synthetic photosystems with enhanced electron transport properties

    • Development of bryophyte-based bioreactors for specialty compound production

  • Biosensors and environmental monitoring:

    • Creation of psbA-based biosensors for herbicides and environmental pollutants

    • Development of field-deployable systems for water quality monitoring

    • High-throughput screening platforms for compounds affecting photosystem function

  • Protein engineering applications:

    • Design of psbA variants with modified herbicide binding properties

    • Engineering of D1 proteins with optimized repair and turnover characteristics

    • Development of photosynthetic proteins with novel cofactor binding properties

  • Bioenergy applications:

    • Optimization of electron transport efficiency for hydrogen production

    • Enhancement of photosynthetic capacity for biofuel feedstock production

    • Engineering of photosystems tolerant to high light conditions for open pond cultivation

  • Evolutionary biotechnology:

    • Application of directed evolution to psbA to develop novel functionalities

    • Creation of hybrid photosystems combining features from different evolutionary lineages

    • Development of ancestral sequence reconstruction techniques to recover primitive photosystem properties

The natural variation documented in Conocephalum conicum psbA sequences, including the seven amino acid substitutions identified across different taxa , provides valuable genetic resources for these biotechnological applications. Understanding how these natural variants affect protein function will inform rational design efforts to engineer photosystem proteins with enhanced properties.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.