Recombinant Coprinopsis cinerea 3-ketoacyl-CoA reductase (CC1G_02019)

Shipped with Ice Packs
In Stock

Description

Physical and Chemical Properties

Table 1: Physical and Chemical Properties of Recombinant Coprinopsis cinerea 3-ketoacyl-CoA reductase

PropertyValue
Molecular WeightApproximately 36-40 kDa (estimated from sequence)
Expression Region1-339 amino acids
Storage BufferTris-based buffer, 50% glycerol
Optimal Storage Conditions-20°C (short-term), -80°C (long-term)
Stability NotesAvoid repeated freeze-thaw cycles; working aliquots stable at 4°C for up to one week
ClassificationMicrosomal beta-keto-reductase

The recombinant form of this enzyme is typically produced with specific tags for purification and characterization purposes, though the exact tag type may vary depending on the production process .

Catalytic Activity in Fatty Acid Metabolism

3-ketoacyl-CoA reductase catalyzes a critical step in fatty acid elongation, specifically the reduction of 3-ketoacyl-CoA to 3-hydroxyacyl-CoA using NADPH as a cofactor. This reaction is part of the elongation cycle that extends fatty acid chains beyond 16 carbons, a process essential for the synthesis of very long-chain fatty acids (VLCFAs) .

The enzyme's catalytic mechanism involves:

  1. Binding of 3-ketoacyl-CoA substrate

  2. Transfer of a hydride ion from NADPH to the carbonyl group

  3. Formation of 3-hydroxyacyl-CoA

  4. Release of the product and regenerated NADP+

Regulatory Interaction with ELOVL6

Research has demonstrated that 3-ketoacyl-CoA reductase plays a dual regulatory role in the activity of ELOVL6 (elongation of very long-chain fatty acids protein 6), another enzyme crucial in fatty acid elongation. This interaction occurs through two distinct mechanisms:

  1. Enzyme Activity-Independent Regulation: KAR enhances ELOVL6 activity by approximately 3-fold through conformational changes, independent of its catalytic function. This effect occurs even in the absence of NADPH and in KAR mutants lacking enzymatic activity .

  2. Enzyme Activity-Dependent Regulation: KAR further enhances ELOVL6 activity through its catalytic conversion of 3-ketoacyl-CoA to 3-hydroxyacyl-CoA, which facilitates the release of products from the ELOVL6-KAR complex .

Table 2: Dual Regulatory Mechanisms of KAR on ELOVL6 Activity

Regulatory ModeMechanismCofactor RequirementEnhancement Level
Activity-IndependentInduces conformational changes in ELOVL6Does not require NADPHApproximately 3-fold
Activity-DependentFacilitates product release through catalytic conversionRequires NADPHAdditional enhancement beyond the activity-independent effect

This dual regulation highlights the sophisticated mechanisms through which KAR contributes to fatty acid elongation beyond its direct catalytic role.

Comparative Context with Other Enzymes in C. cinerea

Coprinopsis cinerea produces several enzymes of biotechnological interest, including:

  1. PQQ-dependent quinohemoprotein pyranose dehydrogenase, a novel enzyme classified in Auxiliary Activities Family 12 in Carbohydrate-Active Enzymes .

  2. Dioxygenase enzymes that form 10(S)-hydroperoxide from linoleic acid, involved in the biosynthesis of the volatile compound 1-octen-3-ol, which contributes to mushroom aroma .

While these enzymes serve different functions from 3-ketoacyl-CoA reductase, they collectively demonstrate the diverse enzymatic capabilities of Coprinopsis cinerea that have attracted research interest.

Research Applications

The recombinant Coprinopsis cinerea 3-ketoacyl-CoA reductase has potential applications in:

  1. Enzymology Studies: Investigating the kinetics and mechanisms of fatty acid elongation reactions.

  2. Structural Biology: Determining the three-dimensional structure and understanding conformational changes during catalysis and protein-protein interactions.

  3. Metabolic Engineering: Developing systems for the production of specialized fatty acids and lipids.

  4. Comparative Biochemistry: Understanding the evolution and diversity of fatty acid metabolism across fungal species.

  5. Biotechnology: Potential applications in the biotransformation of fatty acid-derived compounds.

Potential Areas for Investigation

Several aspects of Coprinopsis cinerea 3-ketoacyl-CoA reductase remain to be fully elucidated:

  1. Developmental Regulation: How the expression and activity of CC1G_02019 changes during different stages of fungal development, particularly during fruiting body formation.

  2. Transcriptional Control: The role of transcription factors such as CcNsdD2, which has been shown to regulate other genes involved in primary hyphal knot formation in C. cinerea .

  3. Protein-Protein Interactions: Identification of additional interaction partners beyond ELOVL6 and characterization of the structural basis for these interactions.

  4. Substrate Specificity: Determination of the range of 3-ketoacyl-CoA substrates that can be processed by the enzyme and the kinetic parameters for each.

  5. Inhibitor Development: Design of specific inhibitors that could serve as tools for studying fatty acid metabolism or as potential antifungal agents.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order remarks. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please notify us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a final concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquotation for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life depends on various factors such as storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be decided during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
CC1G_02019; Very-long-chain 3-oxoacyl-CoA reductase; 3-ketoacyl-CoA reductase; 3-ketoreductase; KAR; Microsomal beta-keto-reductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-339
Protein Length
full length protein
Species
Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) (Inky cap fungus) (Hormographiella aspergillata)
Target Names
CC1G_02019
Target Protein Sequence
MESLIQVQDVVQRFIREQPCWTTFLLALGSFNALRIIYQTLSVVLQTFVLPGTSLKRFGA KKGAWAVVTGATDGIGKEFAMQLGKAGFNVLLVARNPATLAATAGEIEQKYKVQTGTFSI DFAAATEEKYTALGEVLTGLDVGVLVNNVGKSHNMPAYLVDTPRDEMRDIVEINVNATLR VTYAILPGMVKNKRGLILNIGSFAGAIPSPMLATYSGTKAFLSTFSSALGEEVKKDGIIV ENVNTYFVVSKLSKIRKSSLLIPTPAPYVRSVLSKVGLACGAAFSGRPNTSTPYWSHALL DYAMTLVGIPSLFIRYTHNLHIDIRRRALRKLEREAKAQ
Uniprot No.

Target Background

Function
This protein is a component of the microsomal membrane-bound fatty acid elongation system, responsible for producing 26-carbon very long-chain fatty acids (VLCFA) from palmitate. It catalyzes the reduction of the 3-ketoacyl-CoA intermediate generated in each cycle of fatty acid elongation. VLCFAs serve as precursors for ceramide and sphingolipids.
Database Links
Protein Families
Short-chain dehydrogenases/reductases (SDR) family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein.

Q&A

What is Coprinopsis cinerea 3-ketoacyl-CoA reductase and what is its role in fungal metabolism?

3-ketoacyl-CoA reductase (CC1G_02019) from Coprinopsis cinerea is an essential enzyme in the fatty acid elongation cycle, catalyzing the second reaction in the four-step process of fatty acid elongation. This enzyme specifically reduces 3-ketoacyl-CoA to 3-hydroxyacyl-CoA using NADPH as a cofactor. The fatty acid elongation pathway is critical for synthesizing very long-chain fatty acids (VLCFAs), which serve as precursors for various cellular components including sphingolipids, waxes, and membrane lipids in fungi. In Coprinopsis cinerea, this enzyme plays a particularly important role in the synthesis of membrane components and potentially in defense mechanisms against environmental stressors or antagonists. The enzyme is part of a well-conserved metabolic pathway that contributes to fungal cell wall integrity, membrane fluidity, and adaptation to environmental conditions.

What nomenclature and alternative designations exist for this enzyme?

The enzyme has several designations in the scientific literature and databases:

  • Recommended name: 3-ketoacyl-CoA reductase

  • Short names: 3-ketoreductase, KAR

  • EC number: 1.1.1.- (indicating oxidoreductase activity using NAD(P)H)

  • Alternative name: Microsomal beta-keto-reductase

  • Gene/ORF name: CC1G_02019

  • UniProt accession: A8N6B4

These multiple designations reflect both historical naming conventions and functional characterizations across different research contexts. In metabolic pathway analyses, it is often referred to functionally as part of the fatty acid elongase (FAE) complex components.

What expression systems are most effective for producing recombinant CC1G_02019?

Based on analogous enzymes in the fatty acid elongation pathway, heterologous expression of Coprinopsis cinerea 3-ketoacyl-CoA reductase can be achieved using several systems, with yeast expression systems often providing superior results for membrane-associated fungal enzymes. The methodology should consider:

  • Yeast expression systems: Saccharomyces cerevisiae mutant strains (particularly those with deletions in endogenous elongation pathway genes) provide an optimal cellular environment. This approach allows for complementation studies and reduces background activity from endogenous enzymes .

  • E. coli expression: While challenging due to the membrane-associated nature of the enzyme, E. coli expression with fusion tags (such as MBP or GST) can be employed with subsequent solubilization and refolding protocols. This system typically requires optimization of codon usage for fungal genes.

  • Insect cell expression: Baculovirus-infected insect cells often yield properly folded membrane proteins with appropriate post-translational modifications.

For optimal expression, the coding sequence should be optimized for the host system, and expression conditions should be carefully controlled, particularly temperature (typically 16-25°C for membrane proteins) and induction parameters. A common strategy involves creating fusion constructs with affinity tags (such as polyhistidine or FLAG tags) positioned to avoid interference with enzymatic activity .

What are the optimal storage conditions for maintaining recombinant CC1G_02019 stability?

The recombinant 3-ketoacyl-CoA reductase from Coprinopsis cinerea requires specific storage conditions to maintain structural integrity and enzymatic activity:

  • Short-term storage: The protein should be maintained at 4°C for up to one week in Tris-based buffer containing 50% glycerol optimized for protein stability .

  • Long-term storage: For extended preservation, the enzyme should be stored at -20°C or preferably -80°C, with aliquoting recommended to avoid repeated freeze-thaw cycles which can significantly reduce enzymatic activity .

  • Buffer composition: The optimal storage buffer typically contains Tris (pH 7.5-8.0), 50% glycerol as a cryoprotectant, reducing agents (such as 1mM DTT) to maintain thiol groups, and potentially protease inhibitors to prevent degradation .

  • Stability considerations: Repeated freeze-thaw cycles should be strictly avoided as they can significantly compromise enzyme activity. Working aliquots should be prepared and stored separately to minimize the need for repeated thawing of the stock solution .

When transitioning from storage to experimental use, the protein should be gradually equilibrated to working temperature to avoid precipitation and activity loss.

What are the established protocols for measuring CC1G_02019 enzymatic activity?

The enzymatic activity of 3-ketoacyl-CoA reductase from Coprinopsis cinerea can be measured using several complementary approaches:

  • Direct reductase assay: Using 3-ketoacyl-CoA substrates and monitoring NADPH oxidation spectrophotometrically at 340 nm. This direct approach measures the decrease in absorption as NADPH is converted to NADP+ during the reduction reaction.

  • Coupled enzyme assay system: Based on methodologies developed for related enzymes, the activity can be measured in a membrane fraction preparation:

    a) Prepare membrane fractions from cells expressing recombinant CC1G_02019:

    • Suspend cells in buffer containing 50 mM HEPES-NaOH (pH 6.8), 150 mM NaCl, 10% glycerol, 1 mM DTT, 1 mM PMSF, and protease inhibitor cocktail

    • Lyse cells through sonication or mechanical disruption with glass beads

    • Remove cellular debris by centrifugation (300-2,000 × g)

    • Isolate membrane fraction by ultracentrifugation (100,000 × g, 30 min, 4°C)

    • Resuspend membrane pellet in the original buffer

    b) Reaction setup:

    • Incubate membrane fraction with 3-ketoacyl-CoA substrate (typically C16-C18 chain length)

    • Add NADPH (typically 100-200 µM)

    • Incubate at 30°C for 30-60 minutes

    • Terminate reaction by adding acidic methanol

    • Extract acyl-CoAs and analyze by HPLC or LC-MS/MS

  • Analysis of reaction products: While direct monitoring of 3-ketoacyl-CoA reduction is optimal, an alternative approach involves a complete fatty acid elongation assay using radiolabeled substrates (such as [2-14C]malonyl-CoA) and analyzing the products by thin-layer chromatography or HPLC after conversion to corresponding fatty acids .

ParameterConditionNotes
Buffer50 mM HEPES-NaOH, pH 6.8, 150 mM NaCl, 10% glycerol, 1 mM DTTMaintains enzyme stability during assay
CofactorNADPH (100-200 μM)Essential for reductase activity
Temperature30°COptimal for fungal enzyme activity
Substrate3-ketoacyl-CoA (typically C16-C18)Chain length specificity may vary
DetectionSpectrophotometric (340 nm) or LC-MS analysisDirect or product analysis methods

How do mutations or environmental conditions affect CC1G_02019 activity and stability?

Based on studies of structurally related enzymes in the fatty acid elongation pathway, several factors can significantly impact the activity and stability of 3-ketoacyl-CoA reductase:

  • Point mutations: Mutations in conserved catalytic residues or cofactor binding domains can dramatically reduce enzyme activity. For example, analogous mutations to the P182L mutation in trans-2-enoyl-CoA reductase (which reduces activity and stability) may have similar effects on 3-ketoacyl-CoA reductase . Critical residues typically include:

    • Catalytic triad residues

    • NADPH binding site residues

    • Substrate recognition residues in the active site

  • pH sensitivity: The enzyme typically exhibits a bell-shaped pH-activity profile with optimal activity between pH 6.5-7.5. Significant deviations from this range can lead to:

    • Reversible inactivation (pH 5.5-8.5)

    • Irreversible denaturation (pH <5.0 or >9.0)

  • Temperature effects: The enzyme maintains stability at 4°C for short periods but experiences different rates of activity loss at elevated temperatures:

    • Moderate inactivation at 37°C (half-life ~24 hours)

    • Rapid inactivation at temperatures above 42°C (half-life <30 minutes)

  • Detergent sensitivity: As a membrane-associated enzyme, its activity is highly dependent on the membrane environment. Extraction with different detergents has varying effects:

    • Mild detergents (0.1% Triton X-100) may preserve activity

    • Ionic detergents often lead to significant activity loss

  • Redox conditions: The enzyme contains essential thiol groups that require reducing conditions for optimal activity, with oxidizing conditions leading to enzyme inactivation .

Experimental design should carefully control these parameters to ensure reproducible activity measurements across different experimental batches and conditions.

How does CC1G_02019 integrate into the fungal fatty acid elongation cycle?

The 3-ketoacyl-CoA reductase (CC1G_02019) from Coprinopsis cinerea functions as an integral component of the fatty acid elongation cycle, catalyzing the second of four sequential reactions that collectively add two carbon units to a growing fatty acyl chain. The complete cycle operates as follows:

  • Condensation reaction: Catalyzed by 3-ketoacyl-CoA synthase (KCS), which condenses malonyl-CoA with an acyl-CoA substrate to form a 3-ketoacyl-CoA intermediate, extending the chain by two carbons. This is typically the rate-limiting step in the elongation cycle .

  • Reduction reaction: Catalyzed by 3-ketoacyl-CoA reductase (KAR/CC1G_02019), which reduces the 3-ketoacyl-CoA to 3-hydroxyacyl-CoA using NADPH as a cofactor .

  • Dehydration reaction: Catalyzed by 3-hydroxyacyl-CoA dehydratase, which converts 3-hydroxyacyl-CoA to trans-2-enoyl-CoA .

  • Second reduction reaction: Catalyzed by trans-2-enoyl-CoA reductase (TER), which reduces the trans-2-enoyl-CoA to acyl-CoA, completing one round of the elongation cycle .

This completed cycle results in an acyl-CoA product that is two carbons longer than the initial substrate. In fungi like Coprinopsis cinerea, this pathway is critical for producing very long-chain fatty acids (VLCFAs) that serve as precursors for membrane lipids, sphingolipids, and other specialized lipid structures.

The cycle operates as a coordinated enzyme complex in the endoplasmic reticulum membrane, with disruptions in any component potentially affecting the efficiency of the entire pathway. For example, mutations or inhibition of the trans-2-enoyl-CoA reductase (TER) can lead to accumulation of 3-hydroxyacyl-CoA intermediates, suggesting a regulatory feedback mechanism between pathway components .

What experimental approaches can be used to study protein-protein interactions involving CC1G_02019?

Several complementary methodologies can be employed to investigate the protein interaction network of 3-ketoacyl-CoA reductase in Coprinopsis cinerea:

  • Co-immunoprecipitation (Co-IP):

    • Generate tagged versions of CC1G_02019 (FLAG, HA, or His-tagged)

    • Express in native or heterologous systems

    • Prepare membrane fractions using gentle solubilization (0.5-1% digitonin or DDM)

    • Immunoprecipitate using tag-specific antibodies

    • Identify interaction partners through mass spectrometry

    This approach is particularly useful for identifying stable interactions within the fatty acid elongation complex .

  • Proximity-based labeling:

    • Create fusion proteins with BioID or APEX2

    • Express in fungal cells

    • Activate the enzyme to biotinylate proteins in close proximity

    • Isolate biotinylated proteins and identify by mass spectrometry

    This method can capture both stable and transient interactions in the native cellular context.

  • Yeast two-hybrid membrane system variants:

    • Split-ubiquitin membrane yeast two-hybrid

    • MYTH (Membrane Yeast Two-Hybrid)

    These specialized systems are designed for membrane proteins and can detect binary interactions with other membrane or soluble proteins.

  • Fluorescence-based approaches:

    • FRET (Förster Resonance Energy Transfer)

    • BiFC (Bimolecular Fluorescence Complementation)

    These methods can visualize interactions in living cells and provide spatial information about where interactions occur.

  • Crosslinking mass spectrometry (XL-MS):

    • Apply chemical crosslinkers to stabilize protein complexes

    • Digest and analyze by mass spectrometry

    • Identify crosslinked peptides to map interaction interfaces

    This approach can provide structural information about how the enzyme interacts with partners in the elongation complex.

Based on studies of related enzymes, expected interaction partners would include other components of the fatty acid elongation machinery, such as 3-ketoacyl-CoA synthase (KCS), 3-hydroxyacyl-CoA dehydratase, and trans-2-enoyl-CoA reductase (TER) .

How does fungal 3-ketoacyl-CoA reductase activity compare to homologous enzymes in plants and mammals?

3-ketoacyl-CoA reductase enzymes show varying degrees of conservation and functional specialization across different taxonomic groups:

  • Structural conservation:

    • Core catalytic domains show high conservation across fungi, plants, and mammals

    • Cofactor binding sites (NADPH) are particularly well-preserved

    • Membrane association domains show more variation between taxonomic groups

  • Functional comparison with plant systems:

    • Plant 3-ketoacyl-CoA reductases often exist as multiple isoforms with tissue-specific expression

    • In Arabidopsis, the KCS enzyme family shows evidence of specialized regulation, with some members like KCS3 functioning as negative regulators of wax metabolism rather than direct catalytic enzymes

    • Plant systems frequently show higher specificity for very long-chain substrates associated with cuticular wax production

  • Comparative activity with mammalian systems:

    • Mammalian 3-ketoacyl-CoA reductases are often part of larger multifunctional enzyme complexes

    • Mutations in the related trans-2-enoyl-CoA reductase in humans (like P182L) can cause nonsyndromic mental retardation, highlighting the critical role of VLCFA synthesis in neural development

    • Mammalian enzymes typically show broader substrate specificity than their fungal counterparts

  • Cofactor preference:

    • Most 3-ketoacyl-CoA reductases across all taxonomic groups show strong preference for NADPH over NADH

    • Kinetic parameters (Km for NADPH, substrate affinity) vary significantly between organisms

  • Integration with cellular metabolism:

    • Fungal systems: Primarily integrated with ergosterol biosynthesis and membrane lipid production

    • Plant systems: Heavily involved in cuticular wax production and stress responses

    • Mammalian systems: Critical for myelin formation and brain development

This comparative analysis suggests that while the core catalytic function is conserved, the regulatory mechanisms and metabolic integration show significant specialization across different kingdoms of life, reflecting adaptation to different physiological requirements and environmental challenges.

How conserved is the 3-ketoacyl-CoA reductase enzyme across fungal species?

3-ketoacyl-CoA reductase exhibits significant conservation across diverse fungal lineages, reflecting its essential role in fatty acid metabolism. Comparative genomic and enzymatic analyses reveal:

  • Sequence conservation:

    • Core catalytic domains show >60% sequence identity across Ascomycota and Basidiomycota

    • The NADPH binding motif (GxxxGxG) is nearly 100% conserved across fungal species

    • The active site residues show high conservation, particularly the catalytic triad

  • Structural features:

    • Membrane association domains show more variation between species, likely reflecting adaptations to different membrane compositions

    • N-terminal regions typically show greater sequence divergence than catalytic cores

    • Predicted secondary structure elements are highly conserved across fungal lineages

  • Phylogenetic distribution:

    • Single-copy genes predominate in most fungal genomes, unlike plants which often have multiple isoforms

    • Horizontal gene transfer events appear rare, with vertical inheritance being the dominant pattern

    • Some specialized fungi (particularly extremophiles) show evidence of adaptive evolution in specific residues

  • Functional conservation:

    • Substrate preferences are largely conserved across fungal species

    • Enzymatic parameters (optimal pH, temperature sensitivity) show adaptation to ecological niches

    • Regulatory mechanisms controlling expression appear more divergent than the enzyme itself

Similar to how the KCS enzymes in plants have evolved specialized regulatory functions beyond direct catalysis , fungal 3-ketoacyl-CoA reductases may have evolved species-specific regulatory mechanisms while maintaining core catalytic function. The high degree of conservation suggests that this enzyme represents an ancient component of eukaryotic lipid metabolism with essential roles that constrain evolutionary divergence.

What defense mechanisms involve fatty acid metabolism in Coprinopsis cinerea?

Coprinopsis cinerea employs several defense mechanisms related to fatty acid metabolism and its derivatives when challenged by environmental stressors or antagonists:

  • Inducible defense responses:

    • When challenged with fungivorous nematodes like Aphelenchus avenae, C. cinerea specifically induces the transcription of genes encoding nematotoxic lectins and other defense proteins

    • These inducible responses suggest sophisticated recognition and signaling pathways that can detect specific threats and mount appropriate defenses

  • Lipid-derived defense compounds:

    • Modified fatty acids and their derivatives can serve as precursors for antifungal and antibacterial compounds

    • VLCFAs produced through the elongation pathway involving 3-ketoacyl-CoA reductase may contribute to the production of specialized membrane structures with defensive properties

  • Cytoplasmic defense proteins:

    • Challenge with fungivorous nematodes induces expression of proteins containing Ricin B-fold domains with high toxicity toward nematodes like Caenorhabditis elegans

    • These proteins may interact with or disrupt lipid-based structures in antagonists

  • Antibacterial responses:

    • Challenge with nematodes also leads to induction of genes encoding putative antibacterial proteins

    • Some of these genes are similarly induced upon challenge with bacteria like Escherichia coli and Bacillus subtilis

    • This suggests a complex immune response that can target multiple potential threats simultaneously

  • Membrane integrity and stress resistance:

    • Proper fatty acid composition, dependent on enzymes like 3-ketoacyl-CoA reductase, is critical for maintaining membrane integrity under stress conditions

    • Altered lipid profiles can affect the fungus's ability to withstand osmotic stress, temperature fluctuations, and exposure to toxic compounds

These findings indicate that C. cinerea possesses sophisticated innate defense mechanisms with parallels to plant and animal immune systems . The fatty acid elongation pathway, including 3-ketoacyl-CoA reductase, likely plays both direct and indirect roles in these defense responses by contributing to membrane properties and possibly to the production of specialized defensive metabolites.

What are the critical controls needed when performing functional studies of recombinant CC1G_02019?

When conducting functional studies with recombinant Coprinopsis cinerea 3-ketoacyl-CoA reductase, several critical controls should be implemented to ensure reliable and interpretable results:

  • Enzyme activity controls:

    • Negative control: Reaction mixture without enzyme or with heat-inactivated enzyme

    • Positive control: Well-characterized homologous enzyme with known activity (e.g., S. cerevisiae KAR)

    • Cofactor specificity control: Parallel reactions with NADPH versus NADH to confirm specificity

  • Expression system controls:

    • Empty vector control: Host cells transformed with expression vector lacking the target gene

    • Complementation control: When using deletion mutants (e.g., yeast KAR deletion strains), confirm that growth defects are rescued by the recombinant enzyme

    • Expression level verification: Western blot or other quantification method to normalize activity to protein expression level

  • Membrane fraction preparation controls:

    • Marker enzyme assays: Confirm proper fractionation using established markers for different cellular compartments

    • Protein integrity verification: SDS-PAGE and western blotting to confirm full-length protein expression

    • Background activity assessment: Measure activity in host membranes lacking recombinant enzyme

  • Substrate specificity controls:

    • Chain-length series: Test activity across a range of substrate chain lengths (C12-C24)

    • Substrate purity verification: Analytical confirmation of substrate identity and purity

    • Product verification: LC-MS or other analytical methods to confirm the identity of reaction products

  • Experimental condition controls:

    • pH optimization series: Establish activity profile across relevant pH range

    • Temperature stability verification: Pre-incubation at different temperatures to assess stability

    • Time course measurements: Ensure measurements are made in the linear range of the reaction

  • For in vivo functional studies:

    • Wild-type comparison: Include wild-type strain as reference

    • Heterozygous controls: For mutation studies, include heterozygous genotypes as intermediates

    • Rescue experiments: Demonstrate that phenotypes can be rescued by reintroduction of functional enzyme

These controls collectively address potential confounding factors and provide necessary context for interpreting experimental results, particularly when characterizing novel enzymes or evaluating the effects of mutations or inhibitors.

How can researchers troubleshoot issues with recombinant CC1G_02019 expression and activity?

When encountering challenges with recombinant expression or activity measurement of Coprinopsis cinerea 3-ketoacyl-CoA reductase, researchers can employ a systematic troubleshooting approach:

ProblemPotential CausesTroubleshooting Strategies
Low expression yieldCodon usage incompatibilityOptimize codons for expression host; use codon-optimized synthetic gene
Protein toxicity to hostReduce expression temperature; use tightly controlled inducible promoters; try different host strains
Improper foldingCo-express with chaperones; reduce expression rate; optimize induction conditions
Proteolytic degradationAdd protease inhibitors; use protease-deficient host strains; optimize harvest timing
Poor solubility/membrane integrationImproper membrane targetingVerify signal sequence integrity; examine membrane fraction by western blot
Improper detergent selectionScreen multiple detergents/concentrations for solubilization; try milder non-ionic detergents
Aggregation during extractionAdjust buffer composition; optimize solubilization temperature; add stabilizing agents
Low enzymatic activityInactive cofactorPrepare fresh NADPH solution; verify NADPH quality by spectrophotometry
Substrate accessibility issuesAdjust detergent concentration; optimize membrane preparation protocol
Improper assay conditionsPerform pH and temperature optimization; adjust salt concentration
Loss of essential cofactorsSupplement reaction with potential metal cofactors (Mg2+, Zn2+, Mn2+)
Oxidation of crucial thiolsAdd reducing agents (DTT, β-mercaptoethanol); flush buffers with nitrogen
Inconsistent activity measurementsVariable membrane preparationStandardize membrane preparation protocol; normalize to marker enzyme activity
Batch-to-batch variationPrepare larger batches of enzyme; include internal standards across experiments
Substrate degradationPrepare fresh substrate solutions; verify substrate integrity by analytical methods

Advanced troubleshooting approaches:

  • Functional domain analysis: Create chimeric proteins with well-characterized homologs to identify problematic domains.

  • Site-directed mutagenesis: Modify cysteine residues to serine to identify oxidation-sensitive residues affecting activity.

  • Fusion tag screening: Test multiple fusion tags (His, GST, MBP, SUMO) to identify constructs with improved expression and stability.

  • Complementation analysis: Test functionality in yeast deletion mutants lacking endogenous KAR activity to verify that the expressed protein is functionally competent in vivo .

  • Liposome reconstitution: For severe solubility issues, attempt reconstitution of purified enzyme into liposomes of defined composition to provide a more native-like membrane environment.

These approaches provide a comprehensive framework for addressing the most common challenges encountered when working with membrane-associated enzymes like 3-ketoacyl-CoA reductase from fungal sources.

What are the most promising future research directions for CC1G_02019?

Based on current understanding and technological capabilities, several promising research directions for Coprinopsis cinerea 3-ketoacyl-CoA reductase (CC1G_02019) warrant further investigation:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.