Recombinant Coprinopsis cinerea Mitochondrial outer membrane protein IML2 (IML2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
IML2; CC1G_04079; Inclusion body clearance protein IML2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-722
Protein Length
full length protein
Species
Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) (Inky cap fungus) (Hormographiella aspergillata)
Target Names
IML2
Target Protein Sequence
MTNGTPGVPGGEPPHPSAEMLASATKGFDYLFANDIVGSREHFNSKDDPFHLMGAGVIAF LEAALGMETNQVTEASRCLALSETGTRKQMKAPKAKTHSRFPAGLEWDIINADAVVLLGL THALSETYMGYLQCMYSLNNAHSKFTKLYKTVFPAGIDAEEKPPAPAEVAPSSSSTLQVP NGLQHKSSFSSLSSVSSTGSNATLPPAPPSPTQPAVTKSFFSRWLGSSAAAAASEPTLPL HHHQHHHIPDGPVEELIVSGTAFGYGLFNLVFSLLPKKVQSLVGFLGFQHDRKLALKALA LSASKKDVHGVFAGLVLMTYHGVVLLLSGWQADEARIINQYKGIIDNVEERYPEGALWIL NRAKILRMSCDAEGAIRVLQNGLKPERPHSFAQADMMLLFELAWTLLGQRRYQESADSFM KITELNTWSHATYYFLSAGCHFALGNLEKTQELLDAIPGLIHNKKVGGKDLPTEVFIKKK LAFYKEKQKRRCGDEAKFAEAIRINPAEELGIFWNTHARVSKEICKSHVADVLHLTPALT ITSPTITALSSNSNSNPTLPTPASATAAMSSLSLSSKSSTASKTSPPSLSKSKSPLDLDT PDELAVRSLLLGICHRTLEEFDAARKFLLDAHGYQGQVKVNTWVGGVAMFELAVLELKEV EFLEKGGGKVDWMKAMKVADERLDVALSLSPNSVDLSSRLDSRISMLRDEMGIKREMLGG KA
Uniprot No.

Target Background

Function
Recombinant *Coprinopsis cinerea* Mitochondrial outer membrane protein IML2 (IML2) is an inclusion body (IB) resident protein exhibiting strong interaction with lipid droplet (LD) proteins. It plays a role in LD-mediated IB clearance following protein folding stress, likely by facilitating access to IBs of an LD-stored soluble sterol derivative functioning as a chaperone in inclusion clearing.
Database Links
Protein Families
IML2 family
Subcellular Location
Cytoplasm. Nucleus.

Q&A

What is Coprinopsis cinerea and why is it significant as a model organism?

Coprinopsis cinerea (formerly known as Coprinus cinereus) is an ink cap mushroom that serves as a classic experimental model for studying multicellular development in fungi. Its value as a model organism stems from several key characteristics: it grows on defined media, completes its life cycle in just 2 weeks, produces approximately 10^8 synchronized meiocytes, and can be manipulated at all developmental stages through mutation and transformation .

The 37-megabase genome of C. cinerea has been fully sequenced and assembled into 13 chromosomes, providing researchers with comprehensive genetic information. This genomic resource has facilitated numerous studies on fungal multicellularity, development, and evolution .

What expression systems are most suitable for producing recombinant IML2 protein?

For the expression of recombinant IML2 protein, several systems can be considered:

  • E. coli expression system:

    • Advantages: High yield, cost-effective, rapid expression

    • Limitations: May face challenges with proper folding of eukaryotic proteins

    • Optimization: Codon optimization for bacterial expression and inclusion of appropriate solubility tags

  • Yeast expression systems (S. cerevisiae or P. pastoris):

    • Advantages: Post-translational modifications closer to native fungal systems

    • Recommended for: Functional studies requiring properly folded protein

  • Insect cell expression systems:

    • Advantages: Complex eukaryotic protein folding machinery

    • Particularly useful for: Membrane proteins like IML2

When working with recombinant IML2, optimal storage conditions include a Tris-based buffer with 50% glycerol at -20°C for short-term storage or -80°C for extended storage . Repeated freeze-thaw cycles should be avoided to maintain protein integrity.

How can gene silencing techniques be applied to study IML2 function in Coprinopsis cinerea?

RNA silencing has been established as an effective reverse genetics tool for C. cinerea. Based on published methodologies, researchers can apply the following approach to study IML2 function:

  • Construction of hairpin RNA (hpRNA) expression vectors:

    • Design constructs containing IML2 sequences in inverted repeat orientation

    • Include a fungal promoter (e.g., the constitutive gpd promoter or a developmentally regulated promoter)

    • Insert an intron spacer between the inverted repeats to enhance silencing efficiency

  • Transformation protocols:

    • Utilize PEG-mediated transformation of protoplasts

    • Select transformants using appropriate selection markers

  • Validation of silencing efficiency:

    • Quantify reduction in IML2 mRNA levels using quantitative real-time PCR

    • Effective silencing should reduce target gene expression by at least 90%

  • Analysis of silencing mechanisms:

    • Examine DNA methylation patterns at the IML2 locus using bisulfite sequencing

    • Constitutive high-level expression of hairpin RNAs may lead to both transcriptional and post-transcriptional silencing mechanisms

Remember that C. cinerea has been shown to possess both post-transcriptional and transcriptional gene silencing mechanisms. Simultaneous silencing of gene families is possible with a single construct containing sequences from one family member .

What role might IML2 play in gravitropic responses of Coprinopsis cinerea?

Proteomic studies have shown that C. cinerea exhibits distinct gravitropic responses. While mycelium growth appears unaffected by the direction of gravity, fruiting body formation shows a clear negative gravitropic response (growing opposite to the direction of gravity) once primordia have formed .

Potential roles of IML2 in gravitropic responses may include:

  • Signal transduction: Mitochondrial membrane proteins have been implicated in signal transduction pathways. Of the 51 proteins identified in proteomic analyses of gravitropic responses in C. cinerea, approximately 15% were classified as signal transduction proteins .

  • Energy metabolism regulation: As a mitochondrial protein, IML2 may facilitate energy production required for directional growth against gravity.

  • Membrane organization: Structural changes in mitochondrial membranes may be necessary for cellular responses to gravity.

To investigate these possibilities, researchers should consider:

  • Comparing IML2 expression levels in gravitropic vs. non-gravitropic tissues

  • Analyzing the impact of IML2 knockdown on fruiting body orientation

  • Examining protein-protein interactions between IML2 and known components of gravitropic response pathways

How does IML2 relate to developmental processes in Coprinopsis cinerea?

While direct evidence linking IML2 to developmental processes is limited in the current literature, several approaches can be used to investigate this question:

  • Developmental expression profiling:

    • Analyze IML2 expression across developmental stages (mycelium, hyphal knots, primordia, fruiting bodies)

    • Compare expression in different tissue types within developing fruiting bodies

  • Correlation with known developmental regulators:

    • GATA transcription factors like CcNsdD2 regulate developmental fate under different light conditions

    • Examine potential regulatory relationships between these transcription factors and IML2

  • Potential involvement in metabolic shifts:

    • Development of fruiting bodies requires significant metabolic changes

    • As a mitochondrial protein, IML2 may participate in these energetic transitions

The developmental progression of C. cinerea involves distinct stages that may require different mitochondrial functions:

  • Formation of primary hyphal knots

  • Development of secondary hyphal knots or sclerotia (depending on light conditions)

  • Primordium formation

  • Fruiting body maturation

Research has shown that transcription factors like CcNsdD2 play crucial roles in determining whether primary hyphal knots develop into secondary hyphal knots (leading to fruiting bodies) or sclerotia under different light conditions . Investigating potential connections between these regulatory networks and mitochondrial function could provide insights into IML2's role.

What proteomic approaches are most effective for studying IML2 interactions?

For comprehensive analysis of IML2 protein interactions, consider the following methodological approaches:

Table 1: Proteomic Methodologies for IML2 Interaction Studies

MethodologyApplicationAdvantagesConsiderations
Affinity Purification-Mass Spectrometry (AP-MS)Identification of stable protein complexesIdentifies physiologically relevant interactionsRequires antibodies against IML2 or epitope tagging
Proximity Labeling (BioID/APEX)Detection of transient or weak interactionsCaptures spatial relationships in native environmentRequires genetic modification to express fusion proteins
Crosslinking Mass Spectrometry (XL-MS)Structural analysis of protein complexesProvides distance constraints between interacting proteinsRequires optimization of crosslinking conditions
Co-immunoprecipitationVerification of specific interactionsRelatively straightforwardMay miss weak or transient interactions

When analyzing proteomic data for mitochondrial membrane proteins like IML2, specialized data analysis approaches should be employed:

  • Filtering strategies:

    • Apply rigorous statistical thresholds

    • Use control experiments to identify non-specific binders

    • Implement computational tools to prioritize mitochondrial and membrane-associated proteins

  • Network analysis:

    • Construct protein interaction networks

    • Identify hub proteins and functional modules

    • Integrate with existing mitochondrial protein databases

  • Validation experiments:

    • Reciprocal pull-downs

    • Fluorescence microscopy for co-localization

    • Functional assays to assess biological relevance of interactions

Previous proteomic studies on C. cinerea identified 51 proteins involved in gravitropic responses, classified into 13 functional groups . Similar approaches could be applied specifically to IML2.

What genetic tools are available for studying the ImL2 gene in Coprinopsis cinerea?

Several genetic manipulation techniques have been established for C. cinerea that can be applied to study the ImL2 gene:

  • RNA interference (RNAi):

    • Hairpin RNA constructs can effectively reduce ImL2 expression by ≥90%

    • Allows study of gene function without complete knockout

    • Can lead to both transcriptional and post-transcriptional silencing

  • Transformation protocols:

    • PEG-mediated transformation of protoplasts is well-established

    • Homologous recombination for targeted integration

    • Expression vectors with constitutive or inducible promoters

  • Reporter gene fusions:

    • GFP or other fluorescent protein fusions for localization studies

    • Promoter-reporter constructs for expression analysis

  • Genome editing considerations:

    • CRISPR-Cas9 systems are being adapted for basidiomycetes

    • Target site selection should consider genomic features of C. cinerea

When designing genetic experiments, consider that C. cinerea has regions of varying recombination rates across its genome, which may affect the efficiency of homologous recombination-based approaches. High-recombination regions contain many paralogous genes, while low-recombination regions predominantly contain single-copy genes with identifiable orthologs in other basidiomycetes .

What challenges might researchers face when working with recombinant IML2 protein?

Working with mitochondrial membrane proteins like IML2 presents several challenges that researchers should anticipate:

  • Expression and solubility issues:

    • Membrane proteins often form inclusion bodies in bacterial expression systems

    • Solution: Use specialized expression vectors with solubility-enhancing tags or membrane-protein-optimized host strains

  • Protein folding and stability:

    • Proper folding is critical for functional studies

    • Recommendation: Test multiple buffer compositions containing glycerol or mild detergents

    • Optimal storage in Tris-based buffer with 50% glycerol at -20°C or -80°C

  • Functional assay development:

    • Membrane proteins require reconstitution in lipid environments for activity assays

    • Consider liposome reconstitution or nanodiscs for functional studies

    • Develop assays specific to hypothesized functions (e.g., protein transport, membrane integrity)

  • Structural characterization challenges:

    • X-ray crystallography is difficult for membrane proteins

    • Consider alternative approaches like cryo-EM or NMR for structural studies

    • Computational prediction methods can provide initial structural insights

When working with IML2, researchers should implement quality control measures at each step, including SDS-PAGE, Western blotting, and mass spectrometry to verify protein identity and purity.

How should researchers interpret changes in IML2 expression across developmental stages?

When analyzing IML2 expression data across developmental stages of C. cinerea, consider the following analytical framework:

  • Normalization approaches:

    • Use multiple reference genes for qRT-PCR data normalization

    • Select reference genes that maintain stable expression across developmental stages

    • For RNA-seq data, apply appropriate normalization methods (e.g., TPM, RPKM, or DESeq2)

  • Statistical analysis:

    • Apply appropriate statistical tests based on experimental design (e.g., ANOVA for multi-stage comparisons)

    • Use false discovery rate correction for multiple comparisons

    • Distinguish biological from technical variability

  • Interpretation framework:

    • Compare IML2 expression patterns with known developmental marker genes

    • Correlate with expression of transcription factors known to regulate development, such as GATA factors like CcNsdD2

    • Consider co-expression networks to identify functionally related genes

Existing research has identified several genes with stage-specific expression in C. cinerea development, including cyclopropane-fatty-acyl-phospholipid synthases (cfs1-3), galectins (cgl1-3), and hydrophobins (hyd1-3) . Comparing IML2 expression patterns with these established markers can provide context for interpreting your results.

What bioinformatic approaches are useful for predicting IML2 function?

Multiple bioinformatic strategies can provide insights into potential functions of IML2:

  • Sequence-based predictions:

    • Domain prediction tools to identify functional motifs

    • Transmembrane helix prediction (e.g., TMHMM, Phobius)

    • Signal peptide analysis

    • Post-translational modification site prediction

  • Structural predictions:

    • Homology modeling using related proteins with known structures

    • Ab initio modeling for novel domains

    • Molecular dynamics simulations to study membrane interactions

  • Comparative genomic approaches:

    • Ortholog identification across fungal species

    • Synteny analysis to identify conserved genomic context

    • Evolutionary rate analysis to identify functionally constrained regions

  • Functional association networks:

    • Integration of protein-protein interaction data

    • Co-expression network analysis

    • Pathway enrichment analysis

    • Literature-based association mining

The C. cinerea genome has been fully sequenced and assembled into 13 chromosomes , providing a solid foundation for these bioinformatic analyses. Studies have shown that meiotic recombination rates vary greatly along the chromosomes, and retrotransposons are absent in large regions with low recombination. Single-copy genes with identifiable orthologs in other basidiomycetes predominate in low-recombination regions, while paralogous multicopy genes are found in highly recombining regions .

How might IML2 research contribute to our understanding of fungal development?

Research on IML2 could advance our understanding of fungal development in several ways:

  • Mitochondrial regulation of development:

    • Energy metabolism changes during transitions between vegetative growth and fruiting

    • Potential signaling roles of mitochondria in developmental decisions

    • Connection between environmental sensing and cellular energetics

  • Gravitropic responses:

    • Understanding the molecular basis of negative gravitropism in fruiting bodies

    • Linking mitochondrial function to directional growth

    • Comparative analysis with other gravity-responsive systems

  • Light-responsive development:

    • Potential interactions with pathways regulated by GATA transcription factors like CcNsdD2

    • Role in determining developmental fate (secondary hyphal knots vs. sclerotia)

    • Integration of light and gravitropic signals

Future research directions might include:

  • Comprehensive characterization of IML2 interactome across developmental stages

  • Investigation of IML2 role in mitochondrial morphology and dynamics during development

  • Comparative analysis of IML2 function across diverse fungal species

Applying targeted gene silencing approaches, as demonstrated for other genes in C. cinerea , would provide valuable insights into the specific functions of IML2 in these developmental processes.

What controls should be included in experiments involving recombinant IML2?

To ensure robust and reproducible results when working with recombinant IML2, incorporate these essential controls:

  • Expression and purification controls:

    • Empty vector controls processed identically to IML2-expressing constructs

    • Tagged protein controls to assess tag interference

    • Batch-to-batch consistency checks using standard biochemical assays

  • Functional assay controls:

    • Denatured protein controls to distinguish specific from non-specific effects

    • Dose-response relationships to establish specificity

    • Competitive inhibition assays where applicable

  • Genetic manipulation controls:

    • Non-targeting RNAi constructs when using gene silencing

    • Complementation experiments to confirm phenotype specificity

    • Multiple independent transformants to account for position effects

  • Microscopy and localization controls:

    • Co-localization with established mitochondrial markers

    • Controls for fixation artifacts

    • Multiple imaging modalities to confirm observations

When analyzing the effects of genetic manipulations on developmental processes, it's important to note that C. cinerea can follow different developmental pathways depending on environmental conditions. For example, primary hyphal knots can differentiate into either secondary hyphal knots (leading to fruiting bodies) under light/dark rhythm or into sclerotia under constant darkness .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.