Recombinant Coprinopsis cinerea Protein GET1 (GET1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted according to customer specifications.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
GET1; CC1G_02346; Protein GET1; Guided entry of tail-anchored proteins 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) (Inky cap fungus) (Hormographiella aspergillata)
Target Names
GET1
Target Protein Sequence
MSLLLTVFLIVFVTQLISWIGQNVLLEWAYNLYLRLSRNSLAARQRSLKTEILNNKTELL KTSAQDQFAKWAKLRRSVDKGLAELEKLNSEIATAKSSFSTKFNAVIWALTSGVNLVIGW WYGRKAVFYLPEGWMGPLTWWFSFPFAPRGSVSVGVWSFACKRVLLVLERMVKELFFAET QAKEVPVGFSPSSSSSSTPNPMSKASSGSPSPRRRTTVTVESEDEKS
Uniprot No.

Target Background

Function

Essential for the post-translational delivery of tail-anchored (TA) proteins to the endoplasmic reticulum. Functions as a membrane receptor for soluble GET3, which recognizes and selectively binds the transmembrane domain of TA proteins within the cytosol.

Database Links
Protein Families
WRB/GET1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

How does C. cinerea serve as a model organism for GET pathway research?

Coprinopsis cinerea (also known as inky cap fungus) serves as an excellent model organism for several reasons:

  • It grows on defined media and completes its life cycle in just 2 weeks

  • It produces synchronized meiocytes (approximately 10^8)

  • It can be manipulated at all developmental stages through mutation and transformation

  • Its 37-megabase genome has been sequenced and assembled into 13 chromosomes

  • Established genetic tools including targeted gene silencing are available

These characteristics make C. cinerea especially valuable for studying fundamental cellular processes like the GET pathway. The mushroom's genome contains single-copy genes with identifiable orthologs in other basidiomycetes predominantly in low-recombination regions of the chromosome, facilitating comparative genomic studies .

What expression systems and conditions are optimal for recombinant C. cinerea GET1 production?

Recombinant C. cinerea GET1 can be successfully expressed in E. coli expression systems using the following methodological approach:

  • Vector selection: Use vectors containing strong inducible promoters (T7) with appropriate fusion tags

  • Strain selection: BL21(DE3) or specialized membrane protein expression strains (C41/C43)

  • Growth conditions:

    • Media: LB or Terrific Broth supplemented with appropriate antibiotics

    • Temperature: Initial growth at 37°C until OD600 reaches 0.6-0.8

    • Induction: IPTG concentration of 0.1-0.5 mM

    • Post-induction: Lower temperature (18-20°C) for 16-20 hours

The recombinant protein is typically expressed with N-terminal His-tags or other affinity tags to facilitate purification. For functional studies, consider co-expression with interaction partners like GET2 to enhance stability and solubility .

What purification strategies yield high-quality C. cinerea GET1 protein?

A multi-step purification strategy is essential for obtaining pure, functional GET1:

  • Cell lysis: Mechanical disruption in buffer containing protease inhibitors and appropriate detergents

  • Initial purification: Ni-NTA affinity chromatography for His-tagged proteins

  • Secondary purification: Size-exclusion chromatography using Superdex columns

  • Optional tertiary step: Ion-exchange chromatography (MonoS)

Critical considerations include:

  • Buffer composition: 50 mM Hepes, pH 7.5, 15% glycerol, 2 mM DTT

  • Detergent selection: Mild detergents like DDM (n-Dodecyl β-D-maltoside) at 0.03-0.1%

  • Storage conditions: Store in Tris-based buffer with 50% glycerol at -20°C or -80°C for extended storage

Avoid repeated freeze-thaw cycles, and consider working aliquots stored at 4°C for up to one week .

How does the GET1-GET2 heterodimer function in the membrane protein insertion process?

The GET1-GET2 heterodimer functions as a transmembrane receptor complex that coordinates the insertion of tail-anchored proteins. Research using fluorescence measurements and quantitative in vitro insertion analysis has demonstrated:

  • A single GET1/GET2 heterodimer is sufficient for TA protein insertion

  • The conserved cytosolic regions of GET1 and GET2 bind asymmetrically to opposing subunits of the GET3 homodimer

  • GET2's long N-terminal cytosolic domain facilitates initial recruitment of the targeting complex

  • GET1's cytosolic coiled-coil drives TA protein release

  • Following release, the transmembrane domains (TMDs) of both GET1 and GET2 contact the TA protein as it inserts into the bilayer

This process is ATP-dependent, with ATP binding enhancing dissociation of GET3 from the GET1 coiled-coil, facilitating GET3 recycling to the cytosol .

What experimental approaches can determine the oligomeric state of the GET1/GET2 complex?

Multiple complementary approaches can be used to define the oligomeric state of the GET1/GET2 complex:

  • Bulk FRET assays in proteoliposomes:

    • Label GET1 and GET2 at membrane-proximal or cytosolic positions with FRET donor (Cy3) and acceptor (Cy5) fluorophores

    • Reconstitutiing labeled subunits into proteoliposomes in different donor-acceptor combinations

    • Monitor FRET signals in the presence/absence of GET3

  • Single-molecule fluorescence measurements:

    • Use single-molecule techniques to directly count protein complexes in lipid bilayers

    • Combine with functional insertion assays to correlate oligomeric state with activity

  • Engineered single-chain constructs:

    • Create GET2-GET1 single-chain constructs (GET2-1sc) to prevent dissociation during reconstitution

    • Compare activity of vesicles containing defined numbers of these constructs

Research has shown that a single GET1/GET2 heterodimer is sufficient for insertion activity, with higher-order oligomers not being necessary for function .

How does C. cinerea GET1 compare structurally and functionally to homologs in other species?

Comparative analysis reveals both conservation and divergence in GET1 across species:

  • Structural comparison:

    • C. cinerea GET1, like yeast Get1 and mammalian WRB, contains multiple transmembrane domains

    • The cytosolic domains show greater sequence divergence across species while maintaining functional roles

    • Transmembrane topology is relatively conserved across fungi, plants, and mammals

  • Functional conservation:

    • Co-expression of C. cinerea GET1 with G1IP (a GET2-like protein) can weakly rescue growth defects in yeast Δget1get2 mutants under heat stress

    • This indicates some functional conservation despite structural differences

    • The combination of ScGET1 with G1IP performs more weakly than AtGET1 with ScGET2, suggesting GET2/CAML has undergone more structural changes during evolution than the more conserved GET1/WRB

  • Interaction mechanisms:

    • GET1 from different species interacts with its GET2 partner primarily through transmembrane domain associations

    • The cytosolic domains of GET1 are responsible for interaction with GET3, with this mechanism being conserved across species

What insights can we gain from studying GET pathway homologs in plants compared to fungi?

Research on the GET pathway in Arabidopsis thaliana compared to fungi reveals:

These comparative insights suggest evolutionary plasticity in the GET pathway components while maintaining the core functional mechanism.

What fluorescence-based techniques can be applied to study GET1-GET3 interactions?

Several advanced fluorescence techniques can be employed:

  • Ratiometric Bimolecular Fluorescence Complementation (rBiFC):

    • This technique verified the predicted orientation of G1IP and its interaction with AtGET1

    • It can determine specific domains involved in interactions by testing truncated constructs

    • For example, rBiFC demonstrated that G1IP interacts with AtGET1 via its transmembrane domains, not its cytosolic portion

  • Förster Resonance Energy Transfer (FRET):

    • 2in1 FRET constructs can be used for transient expression

    • For example, fusion proteins of AtGET1-EGFP co-expressed with mCherry-tagged binding partners

    • This approach confirmed that G1IP associates with AtGET1 through its transmembrane domains

  • Bulk FRET assays with reconstituted proteins:

    • Label GET pathway components with donor (Cy3) and acceptor (Cy5) fluorophores

    • Reconstitute into proteoliposomes to mimic native membrane environment

    • Monitor FRET signals to detect changes in protein proximity during different steps of the pathway

These techniques provide both qualitative and quantitative information about protein-protein interactions in the GET pathway.

How can liposome reconstitution systems be optimized for studying GET1 function?

Optimizing liposome reconstitution for GET1 functional studies requires attention to several parameters:

  • Liposome preparation:

    • Prepare liposomes at 20 mg/mL via 100 nm extrusion in buffer containing 50 mM HEPES (pH 7.5), 15% glycerol, and 2 mM DTT

    • Consider lipid composition to mimic native ER membrane environment

  • Protein reconstitution protocol:

    • Dilute purified GET1/GET2 protein in detergent-containing buffer (DBC)

    • Add liposomes and incubate (15 minutes at 4°C)

    • Remove detergent by overnight incubation with biobeads

  • Quantification methods:

    • Use fluorescently labeled proteins to quantify reconstitution efficiency

    • Apply single-molecule counting techniques to determine the number of incorporated protein complexes

    • This is critical for establishing structure-function relationships

  • Functional validation:

    • Confirm that reconstituted GET1 maintains its native orientation and activity

    • Perform binding assays with GET3 or insertion assays with tail-anchored protein substrates

This approach allows for controlled study of GET pathway components in a defined membrane environment.

What is known about GET1 expression patterns during C. cinerea development?

While specific expression data for GET1 during C. cinerea development is limited, insights can be drawn from studies of gene expression patterns during fruiting body formation:

  • C. cinerea completes its life cycle through a sexual cycle within 2 weeks in laboratory conditions

  • During development, the fungus progresses through several stages including mycelial growth, fruiting body initiation, and maturation

  • Transcriptomic analyses have been performed during these developmental transitions, revealing complex transcriptional programs

  • Gene expression during fruiting body formation is highly regulated, with specific genes showing stage-specific expression patterns

By analogy with other proteins involved in fundamental cellular processes, GET1 likely maintains consistent expression throughout development to support the insertion of tail-anchored proteins required for various cellular functions.

How might GET1 function influence fungal development and differentiation?

The GET pathway's role in TA protein insertion has several potential implications for fungal development:

  • Membrane protein homeostasis:

    • Proper insertion of TA proteins is critical for ER function, which supports secretory pathway operations during development

    • This is particularly important during rapid growth phases and fruiting body formation

  • Cell differentiation mechanisms:

    • The dikaryotic cells that make up the fungal fruiting body require precise regulation of membrane proteins

    • GET1-mediated insertion of specific TA proteins may contribute to the unique properties of different cell types during development

  • Stress responses during development:

    • Developmental transitions involve cellular stress that requires proper protein quality control

    • The GET pathway contributes to ER homeostasis during these transitions

Research approaches to explore these connections could include:

  • Analysis of GET1 mutant phenotypes during different developmental stages

  • Identification of specific TA proteins whose localization depends on GET1 during development

  • Examination of GET1 expression in specific tissues during fruiting body formation

What methods are effective for studying GET1 loss-of-function in C. cinerea?

Several approaches can be used to study GET1 loss-of-function in C. cinerea:

  • RNA silencing via hairpin constructs:

    • This technique has been successfully applied in C. cinerea for targeted gene silencing

    • Construct design: Create plasmids containing hairpin dsRNA targeting GET1

    • Transformation: Use the homothallic strain AmutBmut (pab1-1) as recipient

    • Expression control: Place the hairpin construct under a constitutive promoter like benA

  • Evaluation of silencing efficiency:

    • RT-PCR to quantify target gene reduction

    • Western blotting to confirm protein level reduction

    • Phenotypic analysis to assess functional consequences

  • Controls and considerations:

    • Include mock transformants as controls

    • Consider potential functional redundancy with GET1 homologs

    • Double knockdowns may be necessary if compensation occurs

This approach has been successfully used for other C. cinerea genes, demonstrating its applicability to GET pathway components .

How can researchers design effective GET1 targeting constructs for gene silencing?

Design considerations for effective GET1 silencing constructs include:

  • Target sequence selection:

    • Choose unique regions of GET1 (200-500 bp) with minimal similarity to other genes

    • Target coding regions rather than UTRs for most efficient silencing

    • Avoid regions with strong secondary structure

  • Hairpin construct design:

    • Include sense and antisense fragments of the target sequence

    • Separate fragments with an intron spacer to enhance stability

    • Place under control of a strong constitutive promoter like C. cinerea benA

  • Vector preparation methods:

    • Utilize stepwise cloning procedures involving E. coli and potentially S. cerevisiae

    • For example, the pRS426 shuttle vector has been successfully used

    • Incorporate selection markers appropriate for C. cinerea transformation

  • Transformation protocol optimization:

    • Use PEG-mediated transformation of C. cinerea protoplasts

    • Select transformants on appropriate media

    • Screen multiple transformants to identify those with highest silencing efficiency

This methodological approach has been validated for multiple C. cinerea genes and can be adapted for GET1 studies .

What controls are essential for validating recombinant C. cinerea GET1 functionality?

A comprehensive set of controls should be included:

Control TypeImplementationPurpose
Protein QualitySize-exclusion chromatography profilesVerify proper folding and oligomeric state
Binding ActivityGET3 interaction assays with wild-type vs. mutant GET1Confirm specific binding capability
Functional ReconstitutionTail-anchored protein insertion with/without GET1Demonstrate physiological activity
Negative ControlsNon-GET pathway membrane proteinsEstablish specificity of interactions
System ValidationYeast complementation with known functional GET1Provide comparative functional baseline

Additionally, researchers should verify:

  • Proper membrane orientation after reconstitution

  • Maintenance of structure during purification steps

  • Appropriate responses to nucleotides (ATP/ADP) in GET3 binding assays

How should researchers analyze and interpret GET pathway reconstitution data?

Methodological approach to data analysis:

  • Quantitative considerations:

    • Determine protein:lipid ratios in reconstituted systems

    • Quantify GET1:GET2:GET3 stoichiometry in experiments

    • Measure insertion efficiency as percentage of input substrate

  • Kinetic analysis:

    • Examine time-dependent changes in substrate insertion

    • Determine rate constants under varying conditions

    • Compare rates between different GET1 variants or experimental conditions

  • Statistical validation:

    • Perform experiments in triplicate minimum

    • Apply appropriate statistical tests based on experimental design

    • Include error bars representing standard deviation or standard error

  • Interpretation frameworks:

    • Compare to established models of GET pathway function

    • Consider alternative explanations for unexpected results

    • Integrate findings with structural and biochemical data from other systems

  • Controls interpretation:

    • Negative controls should show minimal activity

    • Positive controls should demonstrate expected function

    • System-specific controls should address particular aspects of the experimental setup

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.