Recombinant Coprinus comatus Allergen Cop c 5 (cop c5)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
cop; c5; Allergen Cop c 5; allergen Cop c 5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-141
Protein Length
full length protein
Species
Coprinus comatus (Shaggy mane)
Target Names
cop
Target Protein Sequence
MYVAGVSFQQDTMPVLVHRKLEVNHKPPAVKEIVKHLIQVLNPKLHLYLFPVRRNPGYLK FTISLHLFLAHINCIHYSTSKLPSSSTLSSAKRSSISRNSSSSSLSDITMNSSESLPITL SLLSSNIACFLAFSFAFCLAV
Uniprot No.

Target Background

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is Coprinus comatus and its relevance as an allergen source?

Coprinus comatus (shaggy cap) is a species of basidiomycetes with established allergenic properties. Its spores are universal components in the air and have been identified as important causes of respiratory allergies. Research has demonstrated that C. comatus can induce delayed-type reactions in atopic individuals, particularly those with atopic dermatitis (AD) . The ubiquitous nature of Coprinus species spores suggests they should be considered as potential aeroallergens when investigating causes of eczematous skin lesions in AD . As a source of multiple allergens including Cop c 5, understanding the organism's biology provides context for specific allergen studies.

How do researchers assess immune responses to Coprinus comatus allergens?

Assessment of immune responses to C. comatus allergens typically employs multiple complementary methodologies. In controlled studies, researchers have utilized both immediate and delayed hypersensitivity testing. Skin prick tests (SPTs) measure immediate hypersensitivity reactions mediated by IgE antibodies, while atopy patch tests (APTs) evaluate delayed-type hypersensitivity responses .

In clinical research, these tests are typically performed with standardized extracts. For example, APTs have been conducted using extract of C. comatus spore-containing tissue at a concentration of 1.35 mg of protein per gram of petrolatum and C. comatus cap at approximately 5 mg of protein per gram of petroleum jelly . Evaluations are performed after specific time intervals (48 and 72 hours for APTs) to characterize the delayed hypersensitivity response .

For more detailed cellular analysis, researchers examine allergen-responsive CD4+ T cells through detection of CD154 (CD40L) upregulation after 6-18 hours of stimulation with the allergen, combined with staining for chemokine receptors, intracellular cytokines, and transcription factors like Foxp3 .

What is the relationship between Coprinus allergens and atopic dermatitis?

Research has established significant associations between C. comatus allergens and atopic dermatitis. In controlled studies, 32% of subjects with atopic dermatitis showed positive atopy patch test reactions to C. comatus extracts, with 57% of these individuals also demonstrating positive skin prick test responses . This dual positivity suggests both immediate and delayed hypersensitivity mechanisms may contribute to skin manifestations.

Importantly, this reactivity appears to be specific to atopic individuals, as no positive test reactions were observed in nonatopic control subjects . The significantly higher reactivity in AD patients compared to those with only respiratory allergy (32% vs. 9%) indicates a particular relevance of C. comatus allergens to dermatological manifestations of atopy .

These findings align with broader understandings that certain conditions can co-exist with food and environmental allergies while exacerbating symptoms of each other, creating complex immunological interactions that require careful clinical assessment .

How should researchers design experiments to investigate T-cell responses to Cop c 5?

Designing experiments to investigate T-cell responses to Cop c 5 requires careful consideration of multiple variables and controls. Based on established methodologies, researchers should implement the following experimental design principles:

Independent Variable: Typically the allergen concentration or different variants of Cop c 5.
Dependent Variable: Measure of T-cell response (e.g., cytokine production, proliferation).
Controlled Variables: Should include donor characteristics, cell isolation procedures, and culture conditions .

An effective experimental protocol should include:

  • Isolation of peripheral blood mononuclear cells (PBMCs) from allergic and non-allergic donors

  • Stimulation with recombinant Cop c 5 at multiple concentrations

  • Measurement of T-cell activation markers (CD154/CD40L) by flow cytometry

  • Analysis of cytokine production (especially Type 2 cytokines: IL-4, IL-13)

  • Phenotypic characterization using chemokine receptor expression

  • Inclusion of appropriate controls (unstimulated cells, irrelevant allergen)

Analysis should employ statistics of central tendency and variation, with careful attention to significant figures and potential experimental errors . A rigorous approach includes CER (Claim/Evidence/Reason) analysis for data interpretation and identification of outliers .

What T-cell subsets are involved in Cop c 5 allergic responses?

The T-cell response to fungal allergens involves multiple distinct subsets with different functions. Based on allergen research, the following key subsets should be considered when investigating Cop c 5:

Type 2 cells: These IL-4 and IL-13 producing cells represent the predominant response in allergic individuals. Higher proportions of Type 2 cells among allergen-specific T cells correlate with increased sensitivity to allergen exposure and reduced successfully consumed doses (SCD) of allergen .

CCR6+ cells: These cells, often associated with mucosal homing and Th17 responses, show complex relationships with Type 2 cells. Research demonstrates that while both subsets may be elevated in allergic individuals, their proportions among allergen-specific cells are negatively correlated with each other .

Regulatory T cells (Tregs): Characterized by Foxp3 expression, these cells are critical for tolerance development.

T follicular helper cells (Tfh): Particularly Tfh13 cells (expressing CXCR5) have been identified in allergic individuals but not controls, suggesting a role in driving allergen-specific IgE production .

Table 1: T-cell Subset Characteristics in Allergen Responses

T-cell SubsetKey MarkersFunctionClinical Correlation
Type 2 cellsIL-4+, IL-13+, CCR4+Promote IgE productionHigher proportion correlates with lower SCD
CCR6+ cellsCCR6+, variable cytokinesMucosal homingNegatively correlated with Type 2 proportion
TregsFoxp3+, IL-10+Suppress allergic responseIncreased with successful immunotherapy
Tfh13CXCR5+, IL-13+B cell help for IgEPresent in allergic individuals

How does allergen-specific immunotherapy affect T-cell responses to fungal allergens like Cop c 5?

Allergen-specific immunotherapy modulates T-cell responses through multiple mechanisms. When studying Cop c 5 immunotherapy, researchers should investigate:

  • Changes in the proportion of Type 2 cells among allergen-specific responses

  • Alterations in cytokine production profiles

  • Induction of regulatory T-cell responses

  • Shifts in chemokine receptor expression patterns

Successful immunotherapy typically reduces the Type 2 cell dominance of allergen-specific responses. Research in food allergy immunotherapy has demonstrated that treatment success (defined as tolerating a full allergen challenge while on treatment [desensitization] or off treatment [sustained unresponsiveness]) correlates with specific changes in T-cell profiles .

Longitudinal assessment during immunotherapy should employ mixed effects models (REML) with time as a fixed effect and individual as a random effect, followed by appropriate multiple comparison tests to account for repeated measurements .

What methodological approaches should be used to study cross-reactivity between Cop c 5 and other fungal allergens?

Investigating cross-reactivity between Cop c 5 and other fungal allergens requires multi-faceted approaches:

Structural analysis: Bioinformatic comparison of amino acid sequences and predicted three-dimensional structures to identify conserved epitopes.

Immunological inhibition assays: Pre-incubation of patient sera with one allergen before testing reactivity to another can reveal cross-inhibition patterns.

T-cell epitope mapping: Using overlapping peptides spanning the Cop c 5 sequence to identify T-cell epitopes, then testing these epitopes against T-cells specific for other fungal allergens.

Basophil activation testing: Measuring activation markers (CD63, CD203c) on basophils after sequential stimulation with different allergens.

For accurate interpretation, researchers should employ a CER (Claim/Evidence/Reason) framework to analyze potential cross-reactivity, considering both humoral and cellular mechanisms .

How should recombinant Cop c 5 be prepared for immunological studies?

Preparation of recombinant Cop c 5 for immunological studies requires attention to expression systems, purification protocols, and quality control measures:

  • Expression system selection: E. coli systems offer high yield but may lack post-translational modifications. Eukaryotic systems (yeast, insect cells) provide more native-like modifications but with typically lower yields.

  • Purification strategy: Multi-step purification typically includes:

    • Initial capture using affinity chromatography (histidine-tag)

    • Intermediate purification via ion exchange chromatography

    • Polishing step using size exclusion chromatography

  • Quality control:

    • SDS-PAGE for purity assessment

    • Circular dichroism for secondary structure confirmation

    • Endotoxin testing (critical for immunological studies)

    • Mass spectrometry for identity confirmation

  • Allergenicity validation:

    • IgE binding assays using sera from allergic patients

    • Basophil activation tests

    • T-cell stimulation assays

For experimental reproducibility, all materials must be precisely quantified, and detailed procedures must follow a logical sequence with steps for repeated trials clearly defined .

What is the optimal experimental design for evaluating Cop c 5 in atopic dermatitis models?

Evaluating Cop c 5 in atopic dermatitis models requires specific design considerations:

Animal Models:

  • Transgenic mice expressing human IgE receptors

  • NC/Nga mice (spontaneously develop AD-like lesions)

  • Epicutaneous sensitization models

Study Design:

  • Randomization of animals to treatment groups

  • Blinded assessment of outcomes

  • Appropriate sample size calculation

  • Inclusion of positive controls (established allergens) and negative controls

Key Assessments:

  • Clinical scoring of skin lesions (erythema, edema, excoriation, lichenification)

  • Transepidermal water loss measurements

  • Histopathological evaluation (epidermal thickness, inflammatory infiltrate)

  • Local and systemic immunological parameters (IgE, cytokines)

  • T-cell phenotyping from skin and draining lymph nodes

For human studies, protocols similar to those used in previous C. comatus research can be adapted, using standardized extracts at concentrations of 1.35-5 mg protein per gram of vehicle for patch testing .

Statistical analysis should include both measures of central tendency and variation, with calculations reported using correct significant figures .

How do T-cell responses to Cop c 5 correlate with clinical symptoms?

T-cell responses to allergens like Cop c 5 show important correlations with clinical manifestations:

Research has demonstrated that the proportion of Type 2 cells (producing IL-4 and IL-13) among allergen-specific T-cells correlates negatively with successfully consumed dose (SCD) of allergen . This indicates that individuals with stronger Type 2 responses require lower allergen doses to trigger symptoms, reflecting increased sensitivity.

Additionally, the frequency of Type 2 cells has been shown to correlate with clinical presentation. For example, in food allergy studies, subjects with tolerance to heat-modified allergens had significantly lower frequencies of Type 2 cells among their allergen-specific T cells compared to those reactive to both native and heat-modified forms .

These correlations provide valuable biomarkers for predicting clinical reactivity and potentially monitoring therapeutic interventions. When designing studies to investigate such correlations for Cop c 5, researchers should:

  • Precisely characterize clinical phenotypes

  • Collect detailed symptom severity scores

  • Perform controlled allergen challenges when ethically appropriate

  • Correlate cellular markers with both subjective symptoms and objective measurements

What biomarkers can assess the efficacy of Cop c 5-targeted immunotherapy?

Multiple biomarkers can be measured to assess immunotherapy efficacy for Cop c 5 sensitization:

Cellular Biomarkers:

  • Reduction in the proportion of allergen-specific Type 2 cells

  • Increase in Foxp3+ regulatory T-cells

  • Shift from IL-4/IL-13 to IL-10 production in allergen-specific cells

  • Changes in chemokine receptor expression on allergen-responsive cells

Humoral Biomarkers:

  • Decrease in allergen-specific IgE levels

  • Increase in blocking IgG4 antibodies

  • Changes in IgE/IgG4 ratio

Functional Assays:

  • Reduced basophil activation in response to allergen

  • Increased threshold in provocative testing

Microbiome Analysis:

  • Changes in gut microbiota composition may indicate successful immunomodulation, as research has shown that C. comatus polysaccharides can influence gut microbiota in ways that may affect allergic sensitization

Table 2: Immunotherapy Response Biomarkers

Biomarker CategorySpecific MarkersExpected Change with Successful Therapy
T-cell PhenotypeType 2 % of allergen-specific cellsDecrease
Regulatory T-cell frequencyIncrease
CCR6+ cellsVariable
CytokinesIL-4, IL-13 productionDecrease
IL-10 productionIncrease
IFN-γ productionVariable increase
AntibodiesSpecific IgEDecrease
Specific IgG4Increase
IgE/IgG4 ratioDecrease
Basophil ResponseCD63 upregulation thresholdIncrease

How might gut microbiota influence sensitization to Cop c 5?

The relationship between gut microbiota and sensitization to allergens like Cop c 5 represents an emerging area of research. Studies on C. comatus polysaccharides (CCP) provide important insights into potential mechanisms:

Research has demonstrated that CCP can increase the diversity of gut microbiota and induce changes in key bacterial populations. Specifically, CCP administration has been shown to increase the relative abundance of Firmicutes and Lactobacillaceae while decreasing Rikenellaceae . These changes result in positive effects on gut health through a series of prebiotic-like effects.

The ability of CCP to modulate gut microbiota may influence allergic sensitization through:

  • Enhanced intestinal barrier function reducing allergen translocation

  • Modulation of regulatory T-cell responses

  • Altered dendritic cell function affecting allergen presentation

  • Production of short-chain fatty acids with immunomodulatory properties

When designing experiments to investigate these interactions, researchers should consider:

  • Gnotobiotic mouse models to establish causality

  • Metagenomic sequencing for comprehensive microbiome profiling

  • Metabolomic analysis to identify relevant bacterial metabolites

  • Assessment of intestinal permeability and local immune responses

What advanced experimental protocols are needed to investigate oral tolerance to Cop c 5?

Investigating oral tolerance to Cop c 5 requires sophisticated experimental approaches that address multiple aspects of mucosal immunology:

Animal Models:

  • Use of transgenic mice with reporter genes for key tolerance mediators

  • Humanized mouse models expressing human MHC molecules

  • Germ-free and gnotobiotic models to assess microbiome contributions

Experimental Protocol:

  • Oral administration of purified recombinant Cop c 5 at varying doses

  • Analysis of mesenteric lymph node and gut-associated lymphoid tissue responses

  • Assessment of dendritic cell subsets and their conditioning by intestinal epithelial cells

  • Measurement of regulatory T-cell induction and function

  • Challenge phase to test tolerance development (systemic or cutaneous)

Key Measurements:

  • Allergen-specific T-cell responses in different compartments

  • Production of tolerance-associated cytokines (IL-10, TGF-β)

  • Epigenetic modifications in T-cell subsets

  • Changes in gut microbiota composition and function

  • Intestinal barrier integrity markers

This research may benefit from insights regarding CCP's prebiotic-like effects, as these could potentially enhance oral tolerance mechanisms through microbiota modulation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.