Recombinant Coregonus autumnalis Rhodopsin (rho)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested. Advance notification is required for dry ice shipping, and additional fees will apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize development of your specified tag.
Synonyms
rho; Rhodopsin; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-131
Protein Length
full length protein
Species
Coregonus autumnalis (Arctic cisco) (Salmo autumnalis)
Target Names
rho
Target Protein Sequence
CGIDYYTRAPGYNNESFVIYMFIVHFLIPLFIISFCYGNLLCAVKAAAAAQEESETTQRA EREVTRMVIMMVISYLVSWVPYASVAWYIFSNQGSEFGPVFMTIPAFFAKSSALYNPLIY VLMNKQFRHCM
Uniprot No.

Target Background

Function
A photoreceptor essential for low-light image-forming vision. While retinal serves as the chromophore in most saltwater fish species, freshwater fish typically utilize 3-dehydroretinal, or a combination of retinal and 3-dehydroretinal. Light-induced isomerization of 11-cis to all-trans retinal triggers a conformational change that activates signaling through G-proteins. Subsequent receptor phosphorylation, mediated by arrestin, displaces the bound G-protein alpha subunit, terminating the signaling cascade.
Protein Families
G-protein coupled receptor 1 family, Opsin subfamily
Subcellular Location
Membrane; Multi-pass membrane protein. Cell projection, cilium, photoreceptor outer segment.

Q&A

What is Recombinant Coregonus autumnalis Rhodopsin (rho) and what are its basic structural properties?

Recombinant Coregonus autumnalis Rhodopsin (rho) is a G protein-coupled receptor derived from the Arctic cisco (also known as Salmo autumnalis). It functions as a visual pigment that enables vision in low-light conditions. The protein has the following characteristics:

  • Recommended name: Rhodopsin

  • Gene name: rho

  • UniProt accession number: Q90305

  • Absorption maximum (λ max): 510-511 nm, possibly with trace amounts of porphyropsin

  • Amino acid sequence: Contains important aromatic residues that are essential for ligand-induced receptor activation

For optimal research applications, the recombinant protein is typically:

  • Stored in Tris-based buffer with 50% glycerol

  • Maintained at -20°C for regular storage or -20°C/-80°C for extended storage

  • Working aliquots can be kept at 4°C for up to one week

How does the spectral tuning of Coregonus autumnalis rhodopsin compare to other species?

The spectral tuning of Coregonus autumnalis rhodopsin represents an important adaptation to its specific light environment:

  • The absorption maximum (λ max) of Coregonus rhodopsin is approximately 510-511 nm

  • This spectral tuning is similar to many marine fish species but differs from freshwater adaptations

  • Fish rhodopsins demonstrate convergent evolution at specific amino acid positions (like residue 261) that tune absorption properties to match their light environment

  • The absorption characteristics can be influenced by the specific binding of retinal isomers, particularly 11-cis-retinal (native) or 9-cis-retinal (experimental substitute)

Understanding these spectral properties is crucial when designing experiments that involve light activation or spectroscopic analysis of rhodopsin function.

What are the recommended protocols for expression and purification of recombinant Coregonus autumnalis rhodopsin?

While specific optimization is required for each research application, these methodological guidelines have proven effective:

  • Expression systems:

    • E. coli, yeast, baculovirus, and mammalian cell systems have been used successfully

    • For functional studies, mammalian cell lines (particularly HEK293T) often provide better folding and post-translational modifications

  • Purification approach:

    • Solubilization in mild detergents (n-dodecyl-β-D-maltopyranoside is common)

    • Affinity chromatography using appropriate tags (determined during production)

    • Size exclusion chromatography to ensure monodispersity

  • Quality control metrics:

    • Absorption spectrum verification (510-511 nm peak for properly folded protein)

    • SDS-PAGE to confirm molecular weight and purity

    • Thermal stability analysis

    • Functional assays (e.g., G protein activation)

Researchers should avoid repeated freeze-thaw cycles as this significantly reduces activity of the recombinant protein .

What are the optimal methods for analyzing rhodopsin-retinal interactions in experimental settings?

Several complementary approaches provide comprehensive insights into rhodopsin-retinal interactions:

  • Spectroscopic analysis:

    • UV-Vis spectroscopy to determine absorption maxima (λ max)

    • Difference spectroscopy to measure conformational changes upon activation

    • Circular dichroism for secondary structure analysis

  • Computational methods:

    • QM/MM (Quantum Mechanics/Molecular Mechanics) simulations to study chromophore-protein interactions

    • Analysis of electrostatic potential around the retinal binding pocket

    • Visualization of hydrogen bonding networks that stabilize different retinal isomers

  • Binding and stability assays:

    • Fluorescence assays to monitor retinal binding kinetics

    • FRET (Förster Resonance Energy Transfer) analysis to distinguish between properly folded oligomers and misfolded aggregates

    • Thermal stability measurements with differential scanning fluorimetry

For investigating different retinal configurations (9-cis, 11-cis, all-trans), researchers should conduct comparative analyses of absorption spectra using sampled snapshots from QM/MM molecular dynamics trajectories .

How do specific amino acid residues in Coregonus autumnalis rhodopsin affect spectral tuning and protein function?

Research has identified several key residues that significantly influence rhodopsin properties:

  • Residue 261:

    • Only phenylalanine (Phe) and tyrosine (Tyr) are tolerated at this position

    • This residue is critical for spectral tuning in relation to environmental light conditions

    • A Phe261Tyr substitution can cause an ~8-10 nm red shift in absorption maximum

  • Aromatic residues in position 6.44 (Ballesteros & Weinstein numbering):

    • Approximately 75% conservation of Phe and ~7% conservation of Tyr

    • Essential for ligand-induced receptor activation through complex interaction with Trp6.48

  • Retinal binding pocket residues:

    • Geometric configuration of these residues determines the interaction with different retinal isomers

    • Mutations in this region can affect both binding affinity and spectral properties

Researchers should consider these structure-function relationships when designing mutagenesis studies or interpreting spectral data from natural variants.

What methodological approaches can be used to study the stability and aggregation properties of rhodopsin?

Rhodopsin stability and aggregation can be assessed through multiple complementary techniques:

  • FRET-based analysis:

    • Total FRET signal can be analyzed for specific DM (n-dodecyl-β-D-maltoside)-sensitive and DM-insensitive components

    • DM-sensitive FRET indicates oligomers of properly folded rhodopsin

    • DM-insensitive FRET suggests aggregation of misfolded protein

  • Colocalization studies:

    • Fluorescent labeling to track subcellular localization (ER vs. plasma membrane)

    • Colocalization with markers for different cellular compartments

    • Quantitative analysis of trafficking efficiency

  • Stability assessments:

    • Thermal denaturation profiles

    • Chemical denaturation using urea or guanidinium chloride

    • Proteolytic susceptibility assays

  • Aggregation detection:

    • PROTEOSTAT staining for protein aggregates

    • Western blotting to identify oligomeric and aggregated species

    • Size exclusion chromatography to separate monomeric from aggregated forms

These approaches provide valuable insights into protein quality control and can help identify conditions that promote proper folding and prevent aggregation.

How can Coregonus autumnalis rhodopsin be used in evolutionary studies of visual adaptation?

Coregonus autumnalis rhodopsin provides an excellent model for studying visual adaptation across different environments:

  • Comparative genomic approaches:

    • Sequence alignments with rhodopsins from related species

    • Identification of sites under positive selection

    • Construction of phylogenetic trees to trace the evolution of key spectral tuning residues

  • Analysis of convergent evolution:

    • Examination of residue 261 and other key sites across diverse fish species

    • Correlation of amino acid variations with environmental parameters (marine vs. freshwater habitats)

    • Study of parallel adaptations in independently evolved lineages

  • Methodological considerations:

    • Use of ancestral sequence reconstruction to infer evolutionary trajectories

    • Site-directed mutagenesis to recreate ancestral or variant forms

    • Functional characterization of reconstructed proteins to verify adaptive hypotheses

The remarkable example of convergent evolution at amino acid residue 261 in fish transitioning from marine to brackish or freshwater environments demonstrates how rhodopsin can reveal mechanisms of visual adaptation to different light conditions .

What are the key differences between rhodopsin and porphyropsin systems in Coregonus and related species?

Research on visual pigments in Coregonus and related species reveals important differences between rhodopsin and porphyropsin systems:

  • Spectral properties:

    • Coregonus autumnalis rhodopsin: λ max at 510-511 nm

    • Porphyropsin systems (in related species): λ max around 540-541 nm

  • Retinal variants:

    • Rhodopsin: contains vitamin A₁ (retinal)

    • Porphyropsin: contains vitamin A₂ (3,4-dehydroretinal)

    • All species studied have 3-dehydroretinol (porphyropsin precursor) in their livers in proportions ranging from 17-50% of total liver retinols

  • Environmental correlations:

    • Marine environments: predominantly rhodopsin-based systems

    • Freshwater environments: often contain mixtures of rhodopsin and porphyropsin

    • Brackish water: intermediate or variable compositions

Understanding these differences is critical when designing experiments to study visual adaptation in different aquatic ecosystems and when interpreting spectroscopic data from wild-caught specimens.

How can computational modeling enhance our understanding of retinal-rhodopsin interactions in Coregonus autumnalis?

Advanced computational approaches provide valuable insights that complement experimental studies:

  • QM/MM simulation methodology:

    • Hybrid quantum mechanics/molecular mechanics simulations allow detailed study of chromophore-protein interactions

    • Different retinal isomers (9-cis, 11-cis, all-trans) can be systematically compared

    • Electrostatic potential of the protein can be visualized and projected onto the chromophore

  • Key findings from computational studies:

    • Distance between nearby tyrosine residues (e.g., Y126) may play a larger role in determining absorption maximum than the primary counterion (E194)

    • Geometric differences between isomers include structural changes in the polyene chain of the chromophore

    • Alterations in nearby hydrogen bonding networks occur with different isomers

  • Implementation approach:

    • Sample snapshots from QM/MM molecular dynamics trajectories

    • Compare computed absorption spectra to experimental counterparts

    • Analyze specific interactions between protein and chromophore in different conformational states

These computational approaches are particularly valuable for predicting the effects of mutations and understanding the molecular basis of spectral tuning in different environments.

What methodological considerations are important when using recombinant rhodopsin to study retinal diseases and potential therapeutic approaches?

Research on rhodopsin mutations associated with retinal diseases offers important methodological insights:

  • Experimental design considerations:

    • Use of 9-cis-retinal as a photostable isomer of the native 11-cis-retinal

    • Systematic comparison of plasma membrane expression of rhodopsin variants with and without retinal

    • Analysis of variant responsiveness to retinal stabilization

  • Key methodological findings:

    • Mutations exhibit varying degrees of response to retinal supplementation

    • Responses are generally constrained by protein stability

    • Binding calculations suggest many unresponsive variants directly disrupt retinal binding

  • Functional assessment approaches:

    • Regeneration of rhodopsin pigments from purified variants

    • Measurement of residual signaling activity in vitro

    • Correlation of structure-based predictions with experimental observations

This research reveals that many rhodopsin variants exhibit a "correctable" phenotype, suggesting potential therapeutic strategies involving stabilization through small molecules or pharmacological chaperones.

What techniques are most effective for analyzing the spectral properties of Coregonus autumnalis rhodopsin and related visual pigments?

Comprehensive analysis of rhodopsin spectral properties requires multiple complementary approaches:

  • Absorption spectroscopy methodology:

    • UV-visible spectrophotometry of purified rhodopsin in detergent micelles

    • Measurement before and after photobleaching

    • Difference spectroscopy to isolate chromophore contribution

  • Experimental data analysis:

    • Coregonus has a rhodopsin with λ max at 510-511 nm

    • Related species may contain variable amounts of porphyropsin

    • Spectral properties correlate with environmental light conditions

  • Advanced spectroscopic techniques:

    • Resonance Raman spectroscopy to analyze chromophore configuration

    • Time-resolved spectroscopy to study photointermediates

    • Single-molecule FRET to analyze conformational dynamics

Researchers should consider native light environments when interpreting spectral data, as visual pigments are adaptations to specific ecological conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.