Recombinant Corynebacterium aurimucosum UPF0233 membrane protein cauri_0028 (cauri_0028)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Cauri_0028 is commercially available in two recombinant forms:

  1. Full-Length Protein (E. coli Origin):

    • Buffer: Tris/PBS-based buffer with 6% trehalose (pH 8.0) .

    • Reconstitution: 0.1–1.0 mg/mL in deionized water; glycerol (5–50%) recommended for long-term storage .

    • Storage: Lyophilized powder at -20°C/-80°C; avoid repeated freeze-thaw cycles .

  2. Partial Protein (Baculovirus Origin):

    • Purity: >85% .

    • Stability: Liquid form stable for 6 months at -20°C/-80°C; lyophilized form stable for 12 months .

Research Applications and Implications

Though cauri_0028 has not been directly studied in pathogenicity, its role as a membrane protein positions it as a candidate for:

  • Vaccine Development: Membrane proteins are often targets for immunological research .

  • Biochemical Assays: Used to study membrane dynamics or protein-protein interactions in Corynebacterium spp. .

Clinical Context:
While C. aurimucosum is rarely pathogenic, cases of bacteremia and urinary tract infections have been reported, highlighting the need for deeper understanding of its membrane components . For example, a 94-year-old patient with C. aurimucosum bacteremia was treated successfully with amoxicillin/clavulanic acid, underscoring the bacterium’s clinical relevance .

Table 2: Comparative Genomic Features

FeatureC. aurimucosumPathogenic Corynebacteria
Core Genome Genes1,048 (shared)1,048 (shared)
Prophage RegionsϕCauriI (20.7 kb), ϕCauriII (51.5 kb)Variable
CRISPR SystemsPresentPresent (e.g., C. jeikeium)

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery details.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference point.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize its inclusion.
Synonyms
crgA; cauri_0028; Cell division protein CrgA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-91
Protein Length
full length protein
Species
Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CN-1) (Corynebacterium nigricans)
Target Names
crgA
Target Protein Sequence
MPKSKITTEGSALPQSSSSATNRTPVKINSEGTPKWYIAIMLGLMLLGLLWLVVNYLAGE SIPFMQELGPWNYGIGFGLAIIGLLMTMGWR
Uniprot No.

Target Background

Function
This protein is involved in cell division.
Database Links
Protein Families
CrgA family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.