Recombinant Corynebacterium glutamicum ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Corynebacterium glutamicum ATP Synthase Subunit b (atpF)

Corynebacterium glutamicum is an industrial workhorse for amino acid production, and its ATP synthase operon contains eight structural genes and two adjacent genes, cg1360 and cg1361 . Bacterial ATP synthases drive ATP synthesis by a rotary mechanism and play a vital role in cell metabolism and physiology . Recombinant Corynebacterium glutamicum ATP synthase subunit b (atpF) refers to the ATP synthase subunit b (atpF) of Corynebacterium glutamicum produced through recombinant DNA technology . ATP synthase, also known as F0F1-ATPase, is a vital enzyme complex that produces ATP, the primary energy currency in cells . Subunit b is a component of the F0 sector, which is embedded in the cell membrane and facilitates proton transport .

Structure and Function of ATP Synthase Subunit b (atpF) in Corynebacterium glutamicum

The ATP synthase in Corynebacterium glutamicum consists of several subunits, each with a specific role in the enzyme complex's function . Subunit b (atpF) is crucial for the structural integrity and function of the F0 sector, which is responsible for proton translocation across the membrane . The F0 sector harnesses the electrochemical gradient of protons to drive the rotation of the c-ring, which in turn powers ATP synthesis by the F1 sector .

Cg1360 is a hydrophobic protein with four transmembrane helices (TMHs) . Deletion of cg1360 led to significantly reduced cell growth using glucose and acetic acid as carbon sources, and reduced F1 portions in the membrane, suggesting that Cg1360 plays an important role in ATP synthase function .

Methods for Producing Recombinant Corynebacterium glutamicum ATP Synthase Subunit b (atpF)

Recombinant Corynebacterium glutamicum ATP synthase subunit b (atpF) is produced using recombinant DNA technology . The gene encoding atpF is cloned and expressed in a host organism, such as E. coli . The expressed protein is then purified for research and industrial applications .

Impact of cg1360 Deletion on ATP Synthase Function

Research indicates that the deletion of cg1360, a gene associated with ATP synthase function, significantly impacts cell metabolism and ATP production in Corynebacterium glutamicum . A study showed that deleting cg1360 resulted in reduced cell growth when using glucose and acetic acid as carbon sources . The deletion also led to decreased F1 portions in the membrane and reduced ATP-driven proton-pumping activity and ATPase activity, suggesting that Cg1360 plays an important role in ATP synthase function .

The intracellular ATP concentration in the Δcg1360 mutant was decreased to 72% of the wild type, while the NADH and NADPH levels in the Δcg1360 mutant were increased by 29% and 26%, respectively . The final production of L-valine in the V-10-Δcg1360 mutant reached 9.2 ± 0.3 g/l in shake flasks, which was 14% higher than that of the V-10 strain .

Role of ATP Synthase in Corynebacterium glutamicum Metabolism Under Ammonium Limitation

Corynebacterium glutamicum's response to ammonium limitation involves changes in metabolic pathways for nitrogen assimilation, amino acid biosynthesis, and carbon metabolism, as well as a decreased cell division . Transcriptional and proteome profiling has revealed that genes encoding ribosomal proteins and genes for F0F1-ATP synthase subunits are affected by ammonium limitation .

Applications of Recombinant Corynebacterium glutamicum ATP Synthase Subunit b (atpF)

Recombinant Corynebacterium glutamicum ATP synthase subunit b (atpF) has applications, including:

  • Structural and functional studies It can be used to investigate the structure, function, and regulation of ATP synthase .

  • Drug discovery ATP synthase is a target for developing new antimicrobial drugs .

  • Metabolic engineering Understanding the role of ATP synthase subunit b (atpF) can help engineer Corynebacterium glutamicum strains with improved metabolic capabilities .

  • Industrial Biotechnology Cg1360 can be used as an effective engineering target by altering energy metabolism for the enhancement of amino acid production in C. glutamicum .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize development accordingly.
Synonyms
atpF; Cgl1208; cg1364; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-188
Protein Length
full length protein
Species
Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025)
Target Names
atpF
Target Protein Sequence
MANSIYNLAQADALPLESGNSILFPPLYDIVWSLIPFLIILIVFWKLVLPKFQEVLTERE DRIKGGIQRAEAAQAEAKAALEKYNAQLAEARTEAAEIREQARERGKQIEAELKDKANEE SNRIIESGSKQLLAQREQVVNELRREMGQNSINLAEHLLGDQLSDNVKRSGTIDRFLADL DTVAPNGK
Uniprot No.

Target Background

Function
F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the extramembranous catalytic F1 domain and the membrane-bound proton channel F0 domain, linked by a central and peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled to proton translocation through a rotary mechanism involving the central stalk subunits.
Database Links

KEGG: cgb:cg1364

STRING: 196627.cg1364

Protein Families
ATPase B chain family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is the role of subunit b (atpF) in the C. glutamicum ATP synthase complex?

Subunit b (atpF) in C. glutamicum is a critical component of the membrane-bound F₀F₁ ATP synthase complex, functioning as a key element of the peripheral stalk. This stalk serves as a crucial structural component that prevents the α₃β₃ hexamer from rotating with the central rotor during ATP synthesis. The peripheral stalk, composed of b₂δ (two copies of subunit b and one copy of subunit δ), is stabilized by subunit a and connects the membrane-embedded F₀ sector to the catalytic F₁ sector .

ATP synthase functions as a rotary molecular machine, coupling proton translocation across the membrane to ATP synthesis. During this process, the energy derived from proton movement drives the rotation of the c-ring and the attached central stalk (γ, δ, ε), causing conformational changes in the α₃β₃ hexamer that catalyze ATP synthesis. The peripheral stalk, including subunit b, acts as a stator to counter the tendency of the catalytic unit to follow this rotation .

In C. glutamicum, disruption of the atpF gene prevents the formation of a functional ATP synthase complex and significantly impairs energy metabolism, demonstrating its essential nature for proper complex assembly and function .

How does the assembly of ATP synthase in C. glutamicum depend on subunit b?

Assembly of the C. glutamicum ATP synthase follows a modular pathway where subunit b plays a critical role. Research on ATP synthase assembly in bacteria shows that ATP synthase is assembled from distinct subcomplexes, with the peripheral stalk being essential for structural integrity. Studies using single-subunit knock-out mutants demonstrate that:

  • In Δb mutants (where subunit b is deleted), only the F₀F₁ core complex (c₁₀α₃β₃γε) can form

  • The integration of the b dimer into the core complex requires subunit δ

  • Subunit b is inserted independently into the membrane, while subunit a requires co-insertion with other F₀ subunits

This indicates that subunit b is crucial for creating a complete and functional ATP synthase complex. The peripheral stalk that includes subunit b is particularly important for the stability of the c-ring/F₁ complex, as demonstrated in related assembly studies . Without proper assembly of the peripheral stalk, the proton-translocating unit cannot function correctly, leading to compromised energy production.

What are the most effective methods for studying atpF function in C. glutamicum?

To study atpF function in C. glutamicum, several complementary approaches have proven effective:

Genetic Manipulation:

  • CRISPR interference (CRISPRi) technology using deactivated Cas9 (dCas9) to repress gene expression by up to 97-98%

  • Creation of knock-out mutants by introducing early stop codons into the atpF gene

  • Complementation studies with plasmid-based expression of wild-type or mutated atpF

Protein-Protein Interaction Analysis:

  • Intermolecular disulfide bond formation using cysteine-substituted subunits to capture interaction partners

  • Affinity purification of partially assembled F₀F₁ complexes to study assembly intermediates

Functional Assessment:

  • Measurement of ATP synthesis/hydrolysis activities in membrane preparations

  • Proton-pumping activity assays to assess the integrity of the H⁺-translocating unit

  • Growth rate and bioenergetic parameter analyses under various conditions (e.g., different carbon sources)

The advantage of the CRISPRi approach is its rapid implementation (requiring only 3 days from initial cloning to the final engineered strains) , compared to traditional gene deletion methods that depend on rare double-crossover events.

How can recombinant atpF be effectively expressed and purified for structural studies?

Effective expression and purification of recombinant C. glutamicum atpF requires careful consideration of several factors:

Expression Systems:

  • E. coli-C. glutamicum shuttle vectors (such as pZ8-1) under the control of IPTG-inducible Ptac promoter have been successfully used for expression of ATP synthase components

  • Propionate-inducible prpD2 promoter systems offer another regulated expression option in C. glutamicum

Expression Strategy:

  • Clone the atpF gene into an appropriate shuttle vector with a strong, inducible promoter

  • Transform into E. coli for plasmid amplification

  • Transfer to C. glutamicum for expression

  • Induce expression under controlled conditions (temperature, pH, inducer concentration)

Purification Approach:

  • Cell disruption via sonication or French press

  • Membrane fraction isolation by ultracentrifugation

  • Membrane protein solubilization using mild detergents (e.g., n-dodecyl-β-D-maltoside)

  • Affinity chromatography utilizing His-tag or other fusion tags

  • Size exclusion chromatography for final purification and buffer exchange

Key Considerations:

  • Maintaining the native structure requires careful selection of detergents

  • Co-expression with other ATP synthase subunits may improve stability

  • Addition of stabilizing agents (glycerol, specific lipids) can preserve structural integrity

This approach has been validated in studies examining ATP synthase components, though specific optimization may be required for C. glutamicum atpF.

How can manipulation of atpF be used for enhancing amino acid production in C. glutamicum?

Manipulation of ATP synthase components, including atpF, offers strategic approaches for enhancing amino acid production in C. glutamicum through alteration of cellular energetics:

Modulation Strategies:

  • Controlled downregulation: Using CRISPRi to partially repress atpF can alter ATP synthase activity without completely eliminating it, potentially redirecting energy flux

  • Engineering atpF mutations: Introducing specific mutations can modulate ATP synthase efficiency and potentially increase NADH/NADPH ratios

  • Promoter engineering: Replacing native promoters with controllable alternatives allows fine-tuning of expression levels

Production Impacts:
Studies with related ATP synthase components have shown significant effects on amino acid production:

  • Manipulation of the atpG gene (ATP synthase gamma chain) has been used to decrease ATP content and redirect metabolic flux toward desired products

  • In one study, L-valine production was enhanced by 14% through deletion of cg1360, which affects ATP synthase function

Theoretical Basis:

  • Lowering ATP levels can reduce energy consumption for cell growth while maintaining metabolism

  • Modulating the ATP/ADP ratio affects regulatory mechanisms in central metabolism

  • Changes in proton gradient can influence amino acid transport across membranes

This approach takes advantage of the fact that C. glutamicum has been extensively used for industrial amino acid production, particularly L-lysine for animal feed and L-glutamate for food additives, and manipulating energy metabolism can redirect carbon flux toward these valuable products .

What effects does atpF disruption have on C. glutamicum growth and metabolism under different conditions?

Disruption of atpF in C. glutamicum has profound effects on cellular physiology that vary with environmental conditions:

Growth Medium Impacts:

Carbon SourceGrowth Rate EffectMetabolic ImpactATP Level Change
GlucoseSeverely reducedIncreased glycolysis, reduced TCA cycleDecreased to ~70-80% of WT
AcetateSeverely impairedInhibitory effect due to uncoupling activitySignificantly decreased
FructoseModerately reducedAltered pentose phosphate pathway fluxModerately decreased
SucroseModerately reducedSimilar to glucose but less severeModerately decreased

Specific Physiological Responses:

  • Membrane potential: ATP synthase disruption significantly lowers membrane potential, particularly evident when growing on acetate

  • NADH/NADPH ratios: Deletion of ATP synthase components typically leads to increased NADH and NADPH levels (by approximately 25-30%), potentially due to compensatory mechanisms

  • Transcriptional reprogramming: Major changes in genes related to energy metabolism, respiratory chain components, and central carbon metabolism

pH Dependency:

  • The effects of atpF disruption are more pronounced at lower pH values, likely due to increased proton stress on cells with compromised proton-pumping capacity

  • This pH dependency may be exploited for conditional growth control in biotechnological applications

These findings align with observations that ATP synthase disruption creates physiological conditions that resemble anaerobic metabolism even under aerobic conditions, with cells redirecting flux to produce sufficient ATP through substrate-level phosphorylation .

How does atpF interact with other ATP synthase subunits during complex assembly?

The assembly of atpF into the ATP synthase complex follows a sophisticated interaction pattern that has been elucidated through detailed molecular studies:

Key Interaction Partners:

  • Subunit a: Forms a stabilizing interaction with the b-dimer in the membrane sector

  • Subunit δ: Critical for integrating the b-dimer into the core complex

  • c-ring: The b-dimer positions itself relative to the c-ring but does not directly interact with it

Assembly Pathway:
Research using reconstitution systems and subunit knockout studies reveals that ATP synthase assembly follows a modular pathway in which:

  • The c-ring forms independently in the membrane (through YidC insertase)

  • The F₁ sector (α₃β₃γε) assembles separately

  • Subunit b inserts into the membrane independently (via Sec translocon)

  • Subunit δ acts as a "clamp" connecting the b-dimer to the assembled c₁₀α₃β₃γε complex

  • Subunit a is integrated into the complex, requiring both the b-dimer and c-ring

Interaction Mechanisms:

  • The interaction between subunits b and δ involves specific binding regions that have been conserved through evolution

  • The oligomeric state of subunit b (as a dimer, b₂) is essential for proper complex formation

  • Conformational changes in the b-dimer during assembly help position the peripheral stalk correctly

These interactions collectively ensure that the H⁺-translocating unit is properly assembled only within a fully coupled F₀F₁ complex, maintaining low membrane proton permeability that is essential for viability .

What structural and functional differences exist between C. glutamicum atpF and homologous proteins in other bacterial species?

C. glutamicum atpF exhibits several notable structural and functional differences compared to homologous proteins in other bacterial species:

Structural Comparisons:

FeatureC. glutamicumE. coliMycobacteriaChloroflexi
Copy number2 (b₂)2 (b₂)2 (b₂)4 (b₄)
Membrane-spanning regionsSingle transmembrane helixSingle transmembrane helixSingle transmembrane helixSingle transmembrane helix
C-terminal domainInteracts with δ and F₁Interacts with δ and F₁Extended interaction with F₁Different connection to F₁
Length (amino acids)~150-170~156~160-180Variable

Functional Distinctions:

  • Connection to F₁: The specific interactions between atpF and the F₁ sector show species-specific variations that affect the structural rigidity of the peripheral stalk

  • Energetic coupling: The efficiency of energy coupling between proton translocation and ATP synthesis varies between species, partly due to differences in the peripheral stalk architecture

  • Assembly pathway: While the general assembly principles are conserved, the detailed assembly pathways and chaperone requirements differ across bacterial phyla

Evolutionary Considerations:

  • Chloroflexi species, such as Chloroflexus aurantiacus, contain a unique ATP synthase structure with four copies of subunit b per complex instead of the usual two

  • The connection between F₀ and F₁ moieties via the peripheral stalk of b- and δ-subunits is designed differently in these species

  • These variations reflect adaptations to different environmental niches and energetic challenges

This structural diversity highlights the evolutionary adaptability of ATP synthase and suggests that comparative structural analysis of bacterial and archaeal ATP synthases could be a promising research direction .

What are the critical factors for successful expression of functional recombinant atpF in heterologous systems?

Successful expression of functional recombinant C. glutamicum atpF requires careful attention to several critical factors:

Expression System Selection:

  • E. coli systems: While commonly used, may require optimization for membrane protein expression

  • Native C. glutamicum: Often preferred for maintaining authentic post-translational modifications and folding

  • Shuttle vector systems: Enable initial cloning in E. coli followed by expression in C. glutamicum

Promoter and Induction Considerations:

  • Promoter strength: Strong constitutive promoters may lead to toxicity; inducible systems like IPTG-inducible Ptac or propionate-inducible prpD2 offer better control

  • Induction parameters: Temperature, inducer concentration, and induction timing significantly impact yield and functionality

  • Codon optimization: May be necessary when expressing in heterologous hosts

Construct Design:

  • Signal sequences: Retain native membrane-targeting signals for proper insertion

  • Fusion tags: C-terminal tags are generally preferable as N-terminal tags may interfere with membrane insertion

  • Ribosome binding site (RBS): Optimize translation initiation rate for balanced expression

Common Challenges and Solutions:

ChallengeSolution
Toxicity during expressionUse tightly regulated promoters; lower expression temperature
Improper membrane insertionCo-express with chaperones; use homologous expression systems
Poor solubilizationScreen multiple detergents; optimize detergent:protein ratio
Low stability after purificationAdd stabilizing lipids; co-express with interaction partners
Verification of functionalityDevelop activity assays specific to peripheral stalk function

Previous studies have shown that expression of ATP synthase components can stress cellular systems, and careful balancing of expression levels is crucial for obtaining functional protein .

How can researchers troubleshoot issues with ATP synthase assembly when using recombinant atpF?

Troubleshooting ATP synthase assembly issues when using recombinant atpF requires systematic investigation of several potential problem areas:

Assembly Assessment Methods:

  • BN-PAGE (Blue Native PAGE): Enables visualization of assembled complexes and subcomplexes

  • ATP hydrolysis assays: Functional test for assembled F₁F₀ complex

  • Proton pumping assays: Measures proton translocation across membranes

  • Immunoblotting: Detects presence and relative amounts of individual subunits

Common Assembly Problems and Solutions:

ProblemDiagnostic ApproachSolution Strategy
Incomplete complex formationBN-PAGE showing subcomplexesCo-express missing subunits; adjust expression ratios
Unstable complexTime-course stability analysisAdd stabilizing factors; optimize buffer conditions
Incorrect subunit stoichiometryQuantitative MS analysisAdjust expression levels of individual components
Membrane insertion failureMembrane fractionationVerify signal sequences; co-express insertion machinery
Non-functional complexATPase/ATP synthesis assaysCheck for mutations; verify proper assembly sequence

Critical Checkpoints:

  • Subunit δ presence: Acts as a critical "clamp" for integrating the b-dimer into the complex

  • F₁-F₀ connection: Verify proper association between membrane and soluble sectors

  • Proton channel formation: Ensure proper assembly of the proton-translocating unit

Research indicates that ATP synthase assembly follows a modular pathway via subcomplexes, and disruption at key steps can prevent formation of a functional H⁺-translocating unit . By systematically examining these aspects, researchers can identify and address specific assembly issues when working with recombinant atpF.

How can atpF be engineered for enhanced protein production or bioenergetic applications in C. glutamicum?

Engineering atpF offers multiple strategies for enhancing protein production and bioenergetic applications in C. glutamicum:

Protein Production Enhancement:

  • Controlled downregulation: Partial repression of atpF using CRISPRi technology can redirect cellular resources toward recombinant protein production

  • Conditional expression: Engineering atpF expression to respond to metabolite concentrations allows dynamic control of energy metabolism during production phases

  • Structure-based engineering: Targeted mutations in specific regions of atpF can modify ATP synthase efficiency without completely disrupting function

Studies have shown that production of recombinant proteins significantly alters C. glutamicum metabolism, creating conditions resembling anaerobic metabolism even under aerobic conditions . Strategic manipulation of ATP synthase can help manage these metabolic shifts:

Bioenergetic Optimization Approaches:

Engineering TargetApproachExpected Outcome
atpF expression levelPromoter engineering, RBS optimizationFine-tuned ATP production
Interaction with subunit δModification of binding interfaceAltered assembly efficiency
Membrane anchoringEngineering transmembrane domainModified membrane association
Response to regulatory signalsIntroduction of allosteric regulation sitesDynamic control of ATP synthesis

Demonstrated Applications:

  • Expression of recombinant proteins in C. glutamicum leads to significant metabolic adaptation, including enhanced glycolysis, shunted TCA cycle, and accumulation of certain amino acids and organic acids to produce sufficient ATP for protein production

  • These natural adaptations suggest that strategic engineering of ATP synthase components could further optimize the cellular energy economy

This approach leverages insights from studies showing that C. glutamicum naturally reorganizes its metabolism to meet energy demands during recombinant protein production .

What is the relationship between atpF function and stress responses in C. glutamicum?

The function of atpF in C. glutamicum is intricately linked to cellular stress responses through several mechanisms:

pH and Acid Stress:

  • ATP synthase functions critically in maintaining intracellular pH homeostasis

  • Disruption of atpF impairs the cell's ability to cope with acid stress, particularly notable with acetate stress

  • The effects of ATP synthase disruption are more pronounced at lower pH values, creating a pH-dependent growth phenotype

Energy Limitation Stress:

  • When ATP synthase function is compromised, cells activate stress response pathways related to energy limitation

  • This includes transcriptional reprogramming of central carbon metabolism and respiratory chain components

  • Upregulation of substrate-level phosphorylation pathways occurs to compensate for reduced oxidative phosphorylation

Transcriptional Responses:
Research has identified several stress-related transcriptional changes associated with ATP synthase dysfunction:

Stress ConditionTranscriptional ResponseMetabolic Consequence
Acetate stressIncreased sensitivity to protonophores (e.g., CCCP)Lowered membrane potential
Ammonium limitationAltered expression of F₀F₁-ATP synthase subunitsGrowth rate-dependent regulation
Recombinant protein expressionChanges in ribosomal protein, transcriptional regulators, and energy metabolism genesMetabolic shift toward anaerobic-like conditions

Regulatory Connections:

  • ATP synthesis is linked to global transcriptional regulation via the cAMP-GlxR system

  • The GlxR regulator (activated by cAMP) controls expression of the cytochrome bc₁-aa₃ supercomplex, which is the major contributor to proton-motive force

  • A suppressor mutation in GlxR (Ala131Thr) can partially restore growth defects caused by disruption of energy metabolism

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.