Recombinant Corynebacterium glutamicum Cytochrome c oxidase polypeptide 4 (ctaF)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Corynebacterium glutamicum Cytochrome c Oxidase Polypeptide 4 (ctaF)

Recombinant Corynebacterium glutamicum Cytochrome c Oxidase Polypeptide 4 (ctaF) is a protein subunit of the cytochrome c oxidase complex in C. glutamicum, a Gram-positive bacterium widely used in industrial biotechnology. The enzyme is critical for aerobic respiration, catalyzing the transfer of electrons from cytochrome c to oxygen, thereby driving proton pumping and ATP synthesis . Recombinant ctaF is produced via heterologous expression systems, enabling its study in isolation or integration into engineered biological systems.

Genetic Regulation and Expression Systems

ctaF expression is tightly regulated by operons and transcriptional systems. Key regulatory elements include:

  1. NCgl1610 Operon:

    • Encodes a dyp-type heme peroxidase, copper chaperone, and importer .

    • Overexpression enhances cytochrome c oxidase activity and intracellular ATP levels .

  2. Two-Component Systems (TCS):

    • Systems like CitAB/DcuSR regulate membrane transporters and respiratory enzymes in response to environmental cues (e.g., citrate availability) .

  3. Recombineering:

    • Genetic engineering tools, such as RecET-mediated recombination, enable precise insertion of ctaF into C. glutamicum genomes for overproduction .

Production and Secretion Strategies

Recombinant ctaF is typically produced using plasmid-based systems in C. glutamicum. Key methodologies include:

StrategyDescription
Plasmid VectorspXMJ19 (IPTG-inducible) or pET28b (T7 promoter) for controlled expression
Secretion PathwaysSec translocon for unfolded proteins; Tat pathway for folded proteins
Optimization FactorsCalcium supplementation (e.g., CaCl₂) enhances protein stability and yield

Challenges:

  • Proteolytic Degradation: HtrA proteases may degrade recombinant proteins during secretion stress .

  • Low Transformation Efficiency: Requires optimized protocols for plasmid uptake .

Applications in Biotechnology

ctaF serves as a model for studying:

  1. Respiratory Chain Dynamics: Insights into electron transfer mechanisms and proton pumping .

  2. Metabolic Engineering: Enhancing ATP production in C. glutamicum for improved bioproduction (e.g., amino acids, carotenoids) .

  3. Bioenergetic Research: Role of cytochrome c oxidase in maintaining redox balance under oxidative stress .

Research Findings and Implications

  1. Growth Enhancement:

    • Overexpression of NCgl1610 operon increases cytochrome c oxidase activity by 14%, boosting ATP levels by 50% .

    • Engineered strains with upregulated ctaF-related genes exhibit faster doubling times (1.15 h vs. 1.82 h in wild type) .

  2. Comparative Analysis of Oxidases:

    OxidaseProton Translocation EfficiencySubstrate Specificity
    Cytochrome aaHigh (3 H⁺/e⁻)Menaquinol → O₂
    Cytochrome bdLow (1 H⁺/e⁻)Menaquinol → O₂ (emergency function)
  3. Industrial Relevance:

    • Recombinant ctaF could improve C. glutamicum’s performance in bioreactors by optimizing energy metabolism .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ctaF; Cgl2194; cg2408; Cytochrome c oxidase polypeptide 4; Cytochrome aa3 subunit 4; Cytochrome c oxidase polypeptide IV
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-143
Protein Length
full length protein
Species
Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025)
Target Names
ctaF
Target Protein Sequence
MKSSAKLMYGPTVFMAAMAVIYIFATMHVSDGGSVKGVEWVGSVALVLSAGLTLMLGVYL HFTEVRVDVLPEDWEEAEVADKAGTLGFFSPSSIWPAAMSGAVGFLAFGVVYFHYWMIAV GLMLLIFTITKLNLQYGVPKEKH
Uniprot No.

Target Background

Function

Part of cytochrome c oxidase; its function remains uncharacterized.

Database Links

KEGG: cgb:cg2408

STRING: 196627.cg2408

Protein Families
Cytochrome c oxidase bacterial subunit CtaF family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Corynebacterium glutamicum and why is it significant for recombinant protein expression?

Corynebacterium glutamicum is a soil-derived gram-positive actinobacterium that has been extensively used for the production of biochemical molecules including amino acids (L-glutamate and L-lysine), nucleic acids, alcohols, and organic acids. As a recombinant protein expression host, C. glutamicum offers several significant advantages for therapeutic protein production. The bacterium exhibits low protease activity in culture supernatant, allowing it to secrete protease-sensitive proteins effectively . Furthermore, being a gram-positive bacterium, it lacks lipopolysaccharide (endotoxin), which eliminates the need for endotoxin removal during the purification of therapeutic proteins . This characteristic can substantially increase heterologous protein yield by minimizing purification steps.

C. glutamicum has been designated as a Generally Recognized as Safe (GRAS) host for industrial biochemical production, making it particularly favorable for producing high yields of proteins that are difficult to secrete in other hosts or must remain active in a non-pathogenic environment . These features collectively position C. glutamicum as an attractive alternative to traditional expression systems, especially for complex proteins such as cytochrome c oxidase components.

What are the key characteristics of cytochrome c oxidase in C. glutamicum?

Cytochrome c oxidase in C. glutamicum functions as Complex IV in the respiratory chain and possesses several distinctive structural and functional features:

  • It belongs to the cytochrome aa(3) type, but mass spectrometry has revealed that the haem is specifically haem As, containing a geranylgeranyl side-chain instead of the more common farnesyl group .

  • The enzyme is classified as a SoxM-type haem-copper oxidase composed of three primary subunits .

  • The genes encoding these subunits are distributed in the genome, with subunits II (ctaC) and III (ctaE) located upstream of the qcrCAB operon, while the gene for subunit I (ctaD) is positioned separately .

  • A prominent structural feature is the presence of an extra charged amino acid cluster between the β2 and β4 strands in the substrate-binding domain of subunit II, making the β2-β4 loop approximately 30 residues longer than corresponding regions in mitochondrial and proteobacterial cytochrome c oxidases .

  • This extended loop region is rich in both acidic and basic residues, suggesting a specialized function in protein-protein interactions .

The enzyme demonstrates relatively low activity with extrinsic substrates such as cytochromes c from horse heart or yeast, indicating a high degree of specificity for its native electron donor .

What is the functional significance of polypeptide 4 (ctaF) in the cytochrome c oxidase complex?

While the available search results do not provide specific information about ctaF, cytochrome c oxidase systems typically include additional subunits beyond the catalytic core that serve various auxiliary functions. Based on related research on cytochrome c oxidase complexes, polypeptide 4 components often contribute to:

  • Structural stability of the multi-subunit complex

  • Assembly of the holoenzyme during biogenesis

  • Regulation of enzyme activity under different physiological conditions

  • Protection against oxidative damage

  • Facilitation of interactions with other respiratory chain components

For definitive characterization of ctaF's role in C. glutamicum, targeted research approaches would include gene knockout studies, complementation experiments, protein-protein interaction analyses, and structural biology investigations to determine its precise contribution to the cytochrome c oxidase complex.

What are the optimal experimental designs for studying structure-function relationships in cytochrome c oxidase components?

Effective experimental design for structure-function studies of cytochrome c oxidase components requires a systematic approach that encompasses multiple analytical techniques:

A staged experimental strategy is recommended, beginning with:

  • Site-Directed Mutagenesis:

    • Target conserved residues identified through sequence alignment

    • Focus particular attention on the unique regions such as the charged amino acid cluster in subunit II

    • Create a comprehensive library of single amino acid substitutions to map functional domains

  • Expression and Activity Analysis:

    • Express wild-type and mutant proteins in C. glutamicum

    • Develop standardized activity assays using both native and heterologous electron donors

    • Correlate structural modifications with changes in kinetic parameters

  • Structural Determination:

    • Apply X-ray crystallography or cryo-electron microscopy for high-resolution structural analysis

    • Use hydrogen-deuterium exchange mass spectrometry to probe conformational dynamics

    • Implement computational modeling to predict effects of mutations

When designing these experiments, researchers should apply principles of experimental design as outlined in statistical literature, treating simulation studies as statistical sampling experiments subject to established principles . This includes proper definition of experimental regions, selection of appropriate sampling methods, and rigorous analysis of experimental outcomes.

Table 1: Experimental Design Framework for Structure-Function Studies

Study PhaseKey VariablesAnalysis MethodsExpected Outcomes
MutagenesisAmino acid position, Conservation score, Chemical propertiesEnzyme kinetics, Thermal stabilityCritical residues for function
Structural analysisResolution, Sample conditions, Conformational statesDifference maps, Molecular dynamicsStructure-function correlations
Protein-protein interactionsSalt concentration, pH, Binding partnersSPR, Cross-linking MS, Co-IPInteraction surfaces and kinetics

How can researchers effectively analyze experimental data from studies of recombinant cytochrome c oxidase variants?

Analysis of experimental data from recombinant cytochrome c oxidase studies requires a multi-faceted approach:

  • Statistical Framework:

    • Implement mixed-effects models to account for both fixed factors (e.g., mutation type) and random effects (e.g., batch variation)

    • Use multivariate analysis techniques to identify patterns across multiple experimental outcomes

    • Apply meta-analytic methods to synthesize results across different experimental conditions

  • Specialized Analyses for Enzyme Studies:

    • Fit enzyme kinetic data to appropriate mechanistic models (Michaelis-Menten, allosteric, etc.)

    • Analyze spectroscopic data using component analysis to separate overlapping signals

    • Evaluate protein stability using thermal denaturation curves and appropriate statistical models

  • Integration of Structural and Functional Data:

    • Correlate structural parameters with functional outcomes using regression techniques

    • Develop predictive models relating sequence variations to functional changes

    • Apply machine learning approaches to identify complex patterns in structure-function relationships

When analyzing simulation results from computational studies, researchers should treat these as statistical sampling experiments and apply appropriate meta-analytic techniques . This approach permits the relationship between simulation factors and outcomes to be assessed systematically and provides a framework for testing hypotheses about structure-function relationships.

What approaches are most effective for investigating interactions between cytochrome c oxidase and its electron donors?

The unique structural features of C. glutamicum cytochrome c oxidase, particularly the extra charged amino acid cluster in subunit II, suggest specialized interactions with its native electron donors . To investigate these interactions effectively:

  • In Vitro Binding Studies:

    • Surface plasmon resonance (SPR) to measure binding kinetics and affinities

    • Isothermal titration calorimetry (ITC) to determine thermodynamic parameters

    • Analytical ultracentrifugation to characterize complex formation

  • Structural Approaches:

    • Co-crystallization of cytochrome c oxidase with electron donor proteins

    • Cryo-electron microscopy of the transient complexes

    • Molecular docking simulations validated by experimental constraints

  • Functional Validation:

    • Electron transfer kinetics measurements under varying conditions

    • Activity assays using chimeric or mutant electron donors

    • Correlation of binding parameters with electron transfer efficiency

The experimental design should specifically address the hypothesis that the extra charged amino acid cluster between the β2 and β4 strands in subunit II plays a crucial role in electron donor recognition and binding . This can be accomplished through targeted mutations of this region combined with binding and activity studies.

How can simulation studies be designed to predict the behavior of modified cytochrome c oxidase complexes?

Simulation studies for cytochrome c oxidase research should be treated as formal experimental designs requiring careful planning and analysis:

  • Experimental Design for Simulations:

    • Define the parameter space (factors and levels) to be explored

    • Consider using Latin Hypercube Designs (LHD) for efficient exploration of the experimental region

    • Implement space-filling designs to ensure comprehensive coverage of parameter combinations

  • Simulation Implementation:

    • Prepare realistic molecular models incorporating available structural data

    • Apply appropriate force fields calibrated for metalloprotein simulations

    • Conduct sufficient replications to ensure statistical validity

  • Analysis Framework:

    • Analyze simulation outcomes using meta-analytic approaches

    • Calculate effect sizes for different simulation parameters

    • Test interactions between parameters using appropriate statistical models

Table 2: Simulation Parameter Space for Cytochrome c Oxidase Studies

Parameter CategoryVariablesRange/LevelsSampling Method
Structural variationsMutation positions, Side chain propertiesBased on conservation analysisLatin Hypercube Design
Environmental conditionsTemperature, pH, Ionic strengthPhysiological rangesFull factorial
Protein interactionsBinding orientations, Interface distancesBased on preliminary dockingMaximized minimum distance

By applying formal experimental design principles to simulation studies, researchers can maximize the information gained while optimizing computational resources .

How can researchers address contradictions in experimental data regarding cytochrome c oxidase function?

Inconsistencies in experimental findings regarding cytochrome c oxidase function can be systematically addressed through:

  • Standardization of Experimental Approaches:

    • Develop consensus protocols for protein expression and purification

    • Establish standard assay conditions and reference materials

    • Implement consistent data reporting formats

  • Meta-Analysis of Experimental Results:

    • Apply formal meta-analytic techniques to quantitatively synthesize findings across studies

    • Weight studies based on methodological rigor and sample size

    • Test for moderator variables that might explain discrepant results

  • Cognitive Analysis of Research Approaches:

    • Apply cognitive task analysis methods to understand differences in experimental design decisions

    • Use standardized interview techniques to elicit decision processes from researchers

    • Identify potential sources of bias in experimental design or interpretation

  • Targeted Resolution Experiments:

    • Design experiments specifically to test competing hypotheses

    • Implement factorial designs to examine interactions between variables

    • Develop theoretical frameworks that can accommodate apparently contradictory findings

When analyzing conflicting data, researchers should consider adapting the cognitive interview approach described for other fields , which uses standardized techniques to elicit underlying thought processes and decision criteria that might explain divergent findings.

What are the key considerations for heterologous expression of cytochrome c oxidase components in C. glutamicum?

Successful heterologous expression of cytochrome c oxidase components in C. glutamicum requires attention to several critical factors:

  • Genetic Element Optimization:

    • Selection of appropriate promoters based on desired expression levels

    • Optimization of ribosome binding sites and codon usage for efficient translation

    • Integration of effective secretory signal sequences if secretion is desired

  • Expression Strategy Development:

    • Inducible versus constitutive expression systems

    • Cytoplasmic retention versus secretory production

    • Co-expression of multiple subunits and assembly factors

  • Host Strain Engineering:

    • Modification of endogenous proteases to reduce degradation

    • Enhancement of general secretion capacity if applicable

    • Optimization of intracellular oxygen supply, possibly through expression of Vitreoscilla hemoglobin (VHb)

C. glutamicum offers distinct advantages for recombinant protein expression, including low protease activity and absence of endotoxin . These characteristics make it particularly suitable for expression of complex multi-subunit proteins like cytochrome c oxidase. The metabolism of C. glutamicum can be further engineered to increase production, for example, by inducing metabolic flux into the tricarboxylic acid (TCA) cycle .

How can experimental design principles be applied to optimize cytochrome c oxidase studies?

Applying rigorous experimental design principles to cytochrome c oxidase studies enhances both efficiency and validity:

  • Experimental Design Selection:

    • Consider full factorial designs for comprehensive exploration of key factors

    • Employ space-filling designs such as Latin Hypercube Designs for efficient parameter space exploration

    • Apply sequential experimental designs that build on previous findings

  • Factor Selection and Level Determination:

    • Identify critical factors affecting cytochrome c oxidase expression and function

    • Determine appropriate ranges for continuous factors

    • Select meaningful levels for categorical factors

  • Generalizability Considerations:

    • Design experiments to support generalizing results beyond the specific conditions tested

    • Model realistic conditions such as physiologically relevant environments

    • Include sufficient biological and technical replication

Experimental design plays a crucial role because of its ability to produce effects of interest, guide analyses of study outcomes, and enhance generalizability of findings . When studying complex systems like cytochrome c oxidase, attention to experimental design principles becomes even more critical due to the many interacting factors that can influence outcomes.

What analytical techniques are most appropriate for characterizing structural features of cytochrome c oxidase components?

Comprehensive structural characterization of cytochrome c oxidase components requires multiple complementary techniques:

  • High-Resolution Structural Methods:

    • X-ray crystallography for atomic-level static structures

    • Cryo-electron microscopy for capturing different conformational states

    • NMR spectroscopy for dynamic regions and metal center environments

  • Mass Spectrometry-Based Approaches:

    • Mass spectrometry for determining post-translational modifications

    • Hydrogen-deuterium exchange mass spectrometry for conformational dynamics

    • Cross-linking mass spectrometry for mapping protein-protein interfaces

  • Spectroscopic Methods:

    • UV-visible spectroscopy for heme environment characterization

    • Circular dichroism for secondary structure analysis

    • EPR spectroscopy for metalloenzyme active site characterization

As demonstrated in the literature, mass spectrometry has been valuable for determining that the haem in C. glutamicum cytochrome c oxidase is haem As containing a geranylgeranyl side-chain . Similarly, sequencing techniques like Edman degradation have revealed that the N-terminal signal sequence of subunit II is cleaved and the new N-terminal cysteine residue is diacylglycerated .

What statistical approaches are most appropriate for analyzing complex datasets from cytochrome c oxidase studies?

Analysis of complex datasets from cytochrome c oxidase studies requires sophisticated statistical approaches:

  • Multivariate Statistical Methods:

    • Principal Component Analysis (PCA) for dimension reduction

    • Cluster analysis for identifying patterns in multidimensional data

    • Partial Least Squares (PLS) regression for relating structural features to functional outcomes

  • Meta-Analysis Techniques:

    • Effect size calculation to standardize outcomes across different experiments

    • Random-effects models to account for between-study heterogeneity

    • Meta-regression to identify moderator variables explaining differences in outcomes

  • Specialized Analyses for Time-Series and Kinetic Data:

    • Non-linear regression for fitting complex kinetic models

    • Time-series analysis for temporal patterns in enzyme activity

    • Mixed-effects models to separate fixed effects from random variation

When analyzing simulation outcomes, researchers should apply meta-analytic methods to detect patterns in simulation results, treating each simulation outcome as an effect size . This approach permits rigorous assessment of the relationship between simulation factors and outcomes while providing a framework for testing hypotheses.

How can researchers effectively manage and analyze qualitative data in cytochrome c oxidase research?

Qualitative data in cytochrome c oxidase research requires specialized management and analysis approaches:

  • Qualitative Data Collection:

    • Standardized protocols for recording observations

    • Structured formats for capturing expert interpretations

    • Systematic documentation of unexpected findings

  • Analysis Frameworks:

    • Thematic analysis for identifying patterns in qualitative observations

    • Grounded theory approaches for developing conceptual frameworks

    • Integration of qualitative findings with quantitative data

  • Cognitive Interview Techniques:

    • Application of cognitive task analysis methods to understand researcher decision processes

    • Simulation interviews to elicit expertise in experimental design and interpretation

    • Standardized interview techniques for use across distributed research teams

The adaptation of cognitive interview techniques as described in healthcare research can be valuable for cytochrome c oxidase studies, particularly when eliciting expert knowledge about complex systems or when analyzing decision processes in experimental design .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.