Recombinant Corynebacterium glutamicum Cytochrome c oxidase subunit 2 (ctaC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, offered as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
ctaC; Cgl2195; cg2409; Cytochrome c oxidase subunit 2; Cytochrome aa3 subunit 2; Cytochrome c oxidase polypeptide II; Oxidase aa(3 subunit 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
29-359
Protein Length
Full Length of Mature Protein
Species
Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025)
Target Names
ctaC
Target Protein Sequence
CEVAPPGGVLGDFLRMGWPDGITPEAVAMGNFWSWVWVAAWIIGIIMWGLFLTAIFAWGA KRAEKRGEGEFPKQLQYNVPLELVLTIVPIIIVMVLFFFTVQTQDKVTALDKNPEVTVDV TAYQWNWKFGYSEIDGSLAPGGQDYQGSDPERQAAAEASKKDPSGDNPIHGNSKSDVSYL EFNRIETLGTTDEIPVMVLPVNTPIEFNLASADVAHSFWVPEFLFKRDAYAHPEANKSQR VFQIEEITEEGAFVGRCAEMCGTYHAMMNFELRVVDRDSFAEYISFRDSNPDATNAQALE HIGQAPYATSTSPFVSDRTATRDGENTQSNA
Uniprot No.

Target Background

Function
Subunits I and II constitute the enzyme complex's functional core. Electrons from cytochrome c are transferred via heme a and Cu(A) to the binuclear center comprising heme a3 and Cu(B).
Database Links

KEGG: cgb:cg2409

STRING: 196627.cg2409

Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are the optimal promoter systems for expressing recombinant ctaC in C. glutamicum?

Strong synthetic promoters such as H30 and H36 have demonstrated success in driving high-level expression of recombinant proteins in C. glutamicum. Recent studies show that the H36 promoter consistently outperforms H30 in recombinant protein production, with some strains achieving 7-8% higher yields when using H36 . For membrane proteins like ctaC, controlling expression levels is critical to prevent toxicity and misfolding.

Methodology: Test multiple promoter strengths in parallel experiments. Begin with a series of synthetic promoters of varying strengths (e.g., H30, H36) and measure protein yields using Western blotting. Monitor cell growth parameters simultaneously to identify potential expression toxicity. Inducible systems using IPTG can provide additional expression control when toxicity is observed.

How does cultivation pH affect the expression of membrane proteins like ctaC in C. glutamicum?

Methodology: Conduct parallel fermentations at pH values ranging from 6.0-8.0 with 0.5 unit increments. Monitor both biomass formation and protein expression levels. For ctaC specifically, consider that this respiratory chain component may show pH-dependent activity and folding characteristics. Recent studies with other recombinant proteins in C. glutamicum have shown that cultivation at slightly acidic pH (around 6.0) can improve certain protein yields while maintaining acceptable growth rates .

Which secretion pathway is most suitable for ctaC expression in C. glutamicum?

For membrane proteins like ctaC, the Sec translocon is the primary pathway for membrane integration. C. glutamicum possesses functional protein secretion pathways that have successfully been used for recombinant protein secretion at scales ranging from mg/L to g/L .

Methodology: Design expression constructs incorporating the native ctaC signal peptide or test heterologous signal peptides like that from ywaD (which has demonstrated success with other proteins in C. glutamicum) . Compare membrane integration efficiency using subcellular fractionation followed by Western blot analysis. Monitor potential secretion stress responses using reporter strains that indicate upregulation of quality control mechanisms.

What media formulations support optimal membrane protein expression in C. glutamicum?

Defined minimal media are preferred for controlled expression of membrane proteins in C. glutamicum. These media allow for precise control of nutrient availability and simplify downstream purification processes.

Methodology: Compare protein expression in standard CGXII minimal medium versus complex media like 2xTY. For membrane proteins like ctaC, supplement media with specific additives that enhance membrane integrity and protein folding. Recent studies have shown that supplementation with CaCl₂ and Tween 80 can significantly enhance recombinant protein production in C. glutamicum by improving cell envelope properties and reducing protein adsorption to the cell surface .

How can HtrA protease activity be managed to improve ctaC yield and quality?

HtrA proteases function as quality control chaperones that are often upregulated during secretion stress, pH stress, and heat shock. In C. glutamicum, HtrA activity has been shown to limit recombinant protein yields, particularly under stressful cultivation conditions like acidic pH .

Methodology: Consider three parallel approaches:

  • Engineer an HtrA-deficient strain (like C. glutamicum K9) for expression

  • Monitor HtrA levels using proteomic analysis during expression

  • Design culture conditions that minimize HtrA induction (e.g., careful temperature control)

Recent data shows that HtrA-deficient C. glutamicum strains can achieve up to 5-fold higher recombinant protein yields compared to parent strains under identical conditions . When using HtrA-deficient strains, implement careful monitoring of cell stress responses, as these proteases also serve protective functions.

What strategies effectively minimize aggregation of ctaC during expression?

Membrane proteins like ctaC are prone to aggregation during overexpression, which can trigger cellular stress responses and reduce yields.

Methodology: Implement multiple parallel strategies:

  • Test expression at reduced temperatures (25-30°C) to slow protein synthesis and allow proper folding

  • Add membrane-stabilizing agents like glycerol (5-10%) to culture media

  • Co-express molecular chaperones that assist membrane protein folding

  • Optimize aeration conditions, as cytochrome oxidases like ctaC are oxygen-dependent

During expression, monitor protein aggregation using mild detergent solubilization tests on cellular fractions. Recent studies with other recombinant proteins in C. glutamicum revealed that conditions of low aeration prevented activity loss and improved protein titers to approximately 100 mg/L, compared to highly aerated conditions .

How do mutations in cell membrane synthesis genes affect ctaC expression and function?

Cell membrane composition directly impacts the insertion, folding, and function of membrane proteins like ctaC. Mutations in genes related to cell membrane synthesis can alter membrane fluidity and permeability.

Methodology: Screen for temperature-sensitive mutants with altered membrane properties using genomic comparisons between wild-type and industrial strains. Target specific membrane synthesis genes for controlled mutation rather than using random mutagenesis. Recent research identified seven mutant genes related to cell membrane synthesis in an industrial C. glutamicum strain compared to wild-type . When these mutations were introduced into wild-type strains, they showed altered temperature sensitivity and increased membrane permeability .

What analytical methods best characterize the functional integrity of recombinant ctaC?

As an electron transport chain component, ctaC functionality depends on proper membrane integration and cofactor incorporation.

Methodology: Implement a multi-analytical approach:

  • Membrane isolation followed by activity assays measuring electron transfer rates

  • Spectroscopic analysis for heme incorporation (absorption spectra at 550-650 nm)

  • Protein-protein interaction studies with other respiratory chain components

  • Oxygen consumption measurements in membrane vesicles containing recombinant ctaC

Complement functional analyses with structural characterization using circular dichroism to assess secondary structure integrity within the membrane environment.

How can oxygenation conditions be optimized for ctaC expression and activity?

Cytochrome c oxidase is involved in oxygen metabolism, making oxygen availability a critical parameter for both expression and function.

Methodology: Design a respiratory activity profile by varying dissolved oxygen levels in fermentation (from microaerobic to fully aerobic conditions). Monitor ctaC expression levels, enzyme activity, and cell growth simultaneously. Recent studies with other recombinant proteins in C. glutamicum have shown that low aeration conditions can improve certain protein yields, potentially by reducing oxidative stress . For ctaC specifically, balance the oxygen requirements for protein functionality with the optimal conditions for expression and folding.

What are effective purification strategies for maintaining ctaC stability and activity?

Membrane protein purification requires specialized approaches to maintain native structure and function.

Methodology: Establish a systematic purification workflow:

  • Membrane isolation using ultracentrifugation after mechanical disruption

  • Solubilization screening with multiple detergents (DDM, LMNG, etc.) at varying concentrations

  • Affinity chromatography under optimized detergent conditions

  • Size exclusion chromatography to separate monomeric from aggregated protein

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.