Recombinant Corynebacterium glutamicum Glutamate transport system permease protein gluC (gluC)

Shipped with Ice Packs
In Stock

Description

Introduction to the GluABCD Transport System

The glutamate transport system permease protein gluC (gluC) is a critical component of the gluABCD operon in Corynebacterium glutamicum, a gram-positive bacterium widely used for industrial amino acid production. This gene cluster encodes an ATP-binding cassette (ABC) transporter responsible for high-affinity glutamate uptake under specific growth conditions. The system consists of four subunits:

  • GluA: ATP-binding protein

  • GluB: Periplasmic substrate-binding protein

  • GluC/D: Integral membrane permease proteins

GluC functions as a permease subunit, forming part of the transmembrane channel that facilitates glutamate translocation across the cytoplasmic membrane. This system is essential for maintaining intracellular glutamate homeostasis and enabling efficient glutamate assimilation from the environment .

Regulation of GluABCD Expression

The gluABCD operon is dynamically regulated to optimize glutamate uptake based on environmental conditions:

ConditionEffect on ExpressionMechanismSource
Glutamate PresenceInduced expressionUnknown regulatory protein
Glucose PresenceRepressed expressionCatabolite repression
Biotin LimitationNo direct impactUnrelated to uptake system

Experimental Validation
Deletion of the gluABCD cluster reduced glutamate uptake rates from 1.4 nmol/min/mg (wild type) to <0.1 nmol/min/mggluABCD), confirming its dominance in glutamate import .

Recombinant Production and Engineering

While C. glutamicum is a robust host for recombinant protein production (e.g., therapeutic proteins, enzymes), gluC itself is not typically expressed heterologously. Instead, its native expression is optimized through metabolic engineering:

StrategyOutcomeSource
Operon Overexpression3× increase in glutamate uptake rates under inducing conditions
Carbon Source OptimizationEnhanced growth on non-glucose substrates (e.g., pentoses, hexosamines)

Challenges

  • Membrane Protein Production: GluC’s integration into bacterial membranes is challenging to study due to its hydrophobic nature.

  • Protease Sensitivity: While C. glutamicum exhibits low extracellular protease activity, cytoplasmic expression of GluC may require strain-specific optimization .

Research Findings and Applications

Key Studies

  1. Structural-Functional Analysis:

    • Globomycin Treatment: Inhibited ABC transporters, increasing Km from 1.5 µM to 1,400 µM, demonstrating the system’s ATP-dependent high-affinity transport .

    • Gene Deletion: Confirmed gluABCD as the sole glutamate uptake system, with no role in excretion .

  2. Metabolic Engineering:

    • Catabolite Repression Relief: Engineering strains to bypass glucose repression could enhance glutamate uptake in mixed-carbon environments .

  3. Alternative Carbon Sources:

    • Hexosamine Utilization: Co-expression of heterologous PTS systems (e.g., nagE) enables growth on non-food-competing substrates like N-acetyl-D-muramic acid (MurNAc) .

Industrial Relevance

  • Glutamate Production: Optimizing gluABCD expression improves precursor uptake for amino acid biosynthesis.

  • Biorefinery Applications: Engineering C. glutamicum to utilize waste-derived substrates reduces reliance on food-grade feedstocks .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preferred format in your order notes, and we will prepare your order accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. For precise delivery information, please contact your local distributor.
Note: All protein shipments default to standard blue ice packs. For dry ice shipping, please contact us in advance as additional fees apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize the development of your specified tag.
Synonyms
gluC; Cgl1952; cg2138; Glutamate transport system permease protein GluC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-228
Protein Length
full length protein
Species
Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025)
Target Names
gluC
Target Protein Sequence
MSTLWADLGPSLLPAFWVTIKLTIYSAIGAMIFGTILTTMRVSPVKILRTLSTAYINTVR NTPLTLVVLFCSFGLYQNLGLTLAGRESSTFLVDNNFRLAVLGFILYTSTFVAESLRSGI NTVHFGQAEAARSLGLGFGATFRSIIFPQAVRAAIVPLGNTLIALTKNTTIASVIGVGEA SLLMKATIENHANMLFVVFAIFAVGFMILTLPMGLGLGKLSERLAVKK
Uniprot No.

Target Background

Function
This protein is a component of the binding-protein-dependent transport system for glutamate. It is likely responsible for the translocation of the substrate across the membrane.
Database Links

KEGG: cgb:cg2138

STRING: 196627.cg2138

Protein Families
Binding-protein-dependent transport system permease family, HisMQ subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.