Recombinant Corynebacterium glutamicum Menaquinol-cytochrome c reductase cytochrome c subunit (qcrC)

Shipped with Ice Packs
In Stock

Description

Introduction to qcrC Protein

Corynebacterium glutamicum is a gram-positive soil bacterium with remarkable industrial importance, particularly for the large-scale production of amino acids including L-glutamate and L-lysine . This organism possesses a branched respiratory chain with two terminal oxidases that facilitate efficient energy metabolism under varying conditions . The qcrC protein functions as the cytochrome c subunit of the menaquinol-cytochrome c reductase (also known as the cytochrome bc1 complex), which constitutes an essential component of the respiratory electron transport chain required for ATP synthesis .

The cytochrome bc1 complex catalyzes the oxidation of menaquinol and the reduction of cytochrome c in the respiratory chain, operating through a Q-cycle mechanism that couples electron transfer to the generation of a proton gradient driving ATP synthesis . Unlike many other bacteria, C. glutamicum possesses a unique respiratory organization where the cytochrome bc1 complex forms a supercomplex with cytochrome aa3 oxidase, with qcrC serving as the electronic connector between these complexes .

Unique Heme-Binding Domains

One of the most remarkable features of the qcrC protein is the presence of two Cys-X-X-Cys-His motifs for covalent heme attachment, indicating that it functions as a diheme c-type cytochrome . This characteristic is unusual compared to most cytochrome c1 proteins, which typically contain only a single heme group. Analysis of the deduced primary structure confirms that cytochrome c1 (QcrC) contains these two motifs, making it the only c-type cytochrome expressed in C. glutamicum .

Membrane Association

The qcrC protein contains a hydrophobic transmembrane region that anchors it to the cytoplasmic membrane . This membrane association is critical for its proper positioning within the respiratory chain supercomplex and enables efficient electron transfer between complex III and complex IV components .

Supercomplex Formation

In C. glutamicum, respiratory complexes III and IV form a CIII2-CIV2 supercomplex that catalyzes the oxidation of menaquinol and the reduction of dioxygen to water . Structural analysis by cryo-electron microscopy at 2.9 Å resolution reveals a central CIII2 dimer flanked by a CIV on two sides, with qcrC functioning as a di-heme cytochrome cc subunit that electronically connects each CIII with an adjacent CIV . This arrangement is considered typical for aerobic Actinobacteria and represents an efficient organization for electron transfer .

Energetic Efficiency

The cytochrome bc1-aa3 pathway in C. glutamicum demonstrates higher proton translocation efficiency compared to the alternative cytochrome bd oxidase pathway. While both pathways transfer reducing equivalents from menaquinol to oxygen, they differ in their proton translocation efficiency by a factor of three . This difference in efficiency makes the bc1-aa3 pathway the main route of respiration under many growth conditions, particularly in glucose minimal medium .

Expression Systems

Recombinant qcrC protein can be successfully expressed in heterologous hosts, primarily Escherichia coli . The protein is typically produced with affinity tags such as a histidine tag (His-tag) at the N-terminus to facilitate purification . The expression is optimized to ensure proper folding and incorporation of the heme groups.

Purification Methods

The purification of recombinant qcrC typically employs affinity chromatography, leveraging the engineered His-tag . After initial capture, the protein may undergo additional purification steps to achieve high purity (>90% as determined by SDS-PAGE) . The final product is often provided as a lyophilized powder with defined storage conditions .

Respiratory Chain Studies

Recombinant qcrC protein serves as a valuable tool for investigating the respiratory mechanisms of C. glutamicum and related Actinobacteria. It enables detailed studies of electron transfer processes, supercomplex formation, and the energetics of respiration . Such research provides fundamental insights into bacterial energy metabolism and has implications for understanding similar systems in pathogenic relatives like Mycobacterium tuberculosis .

Metabolic Engineering

Studies involving recombinant qcrC contribute to metabolic engineering efforts aimed at improving amino acid production by C. glutamicum. Research has shown that manipulating the respiratory chain can impact lysine production, with a deletion of the alternative cytochrome bd oxidase genes (cydAB) increasing lysine production by approximately 12% . Understanding the role of qcrC and the bc1-aa3 pathway provides additional targets for optimizing industrial strains.

Branched Respiratory Chain

C. glutamicum possesses a branched respiratory chain with two main branches: one involving the cytochrome bc1 complex (including qcrC) and cytochrome aa3 oxidase, and the other utilizing cytochrome bd-type menaquinol oxidase . This branching allows the bacterium to adapt to varying oxygen availability and energy demands .

Environmental Regulation

The expression of respiratory chain components in C. glutamicum is regulated by environmental factors, including copper availability. Research has shown that Cu2+ ion supplementation can increase the promoter activities of cytochrome aa3 oxidase in the early stationary phase by 1.49-fold to 1.99-fold compared to control conditions . This regulation influences the balance between the two respiratory branches, with copper ions capable of switching the flux between them .

Impact on Growth and Metabolism

The bc1-aa3 pathway, in which qcrC participates, is the main route of respiration under certain growth conditions. Deletion of the qcrCAB genes results in strongly impaired growth in glucose minimal medium, highlighting the importance of this pathway for energy metabolism . Conversely, constitutive overproduction of the alternative cytochrome bd oxidase reduces growth rate and maximal biomass formation, presumably due to increased electron flow through the less efficient oxidase .

Comparison with Other Bacterial Cytochrome c Subunits

The qcrC protein from C. glutamicum differs from cytochrome c subunits in other bacteria primarily due to its diheme nature. Table 1 compares key features of qcrC with homologous proteins from selected organisms:

OrganismProteinNumber of Heme GroupsMolecular Weight (kDa)Key Distinguishing Features
C. glutamicumqcrC2~31Diheme structure, only c-type cytochrome in the organism
C. diphtheriaeqcrC2~30Diheme structure, similar to C. glutamicum qcrC
E. coliCycA1~12Soluble periplasmic protein, single heme
B. subtilisQcrC1~28Single heme, part of menaquinol:cytochrome c oxidoreductase

The diheme structure of C. glutamicum qcrC is particularly significant as it likely enables this single cytochrome c protein to fulfill both the roles of cytochrome c1 and a soluble cytochrome c, which are typically separate proteins in other organisms .

Evolutionary Significance

The unique structure and arrangement of the respiratory chain in C. glutamicum and related Actinobacteria represent a distinct evolutionary adaptation. The presence of a diheme cytochrome c1 as the only c-type cytochrome in the organism suggests an efficient solution to maintain electron transfer without requiring a separate soluble cytochrome c . This arrangement is considered typical for aerobic Actinobacteria and may reflect adaptation to their ecological niches .

Biotechnological Applications

The insights gained from studying qcrC and the respiratory chain of C. glutamicum have potential applications in metabolic engineering for enhanced amino acid production. Given that manipulation of the respiratory chain has already shown promise in improving lysine yields , further fine-tuning based on a deeper understanding of qcrC function could lead to more efficient industrial strains.

Comparative Studies with Pathogenic Actinobacteria

The similarities between the respiratory systems of C. glutamicum and pathogenic Actinobacteria such as Mycobacterium tuberculosis suggest that research on qcrC could inform therapeutic strategies . Comparative studies could identify unique features or vulnerabilities in the respiratory chains of pathogens that might be targeted by novel antimicrobial agents.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a particular tag, please specify it in advance, and we will prioritize its use.
Synonyms
qcrC; Cgl2191; cg2405; Cytochrome bc1 complex cytochrome c subunit; Cytochrome c1; Cytochrome bc1 reductase complex subunit Qcrc; Menaquinol--cytochrome c reductase cytochrome c subunit
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-283
Protein Length
full length protein
Species
Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025)
Target Names
qcrC
Target Protein Sequence
MAKPSAKKVKNRRKVRRTVAGALALTIGLSGAGILATAITPDAQVATAQRDDQALISEGK DLYDVACITCHGVNLQGVEDRGPSLVGVGEGAVYFQVHSGRMPILRNEAQAERKAPRYTE AQTLAIAAYVAANGGGPGLVYNEDGTLAMEELRGENYDGQITSADVARGGDLFRLNCASC HNFTGRGGALSSGKYAPNLDAANEQEIYQAMLTGPQNMPKFSDRQLSADEKKDIIAFIKS TKETPSPGGYSLGSLGPVAEGLFMWVFGILVLVAAAMWIGSRS
Uniprot No.

Target Background

Function

Cytochrome c1 is a subunit of the cytochrome bc1 complex, a critical component of the respiratory electron transport chain essential for ATP synthesis. This complex catalyzes the oxidation of menaquinol and the reduction of cytochrome c, operating via a Q-cycle mechanism that couples electron transfer to proton gradient generation, thereby driving ATP synthesis.

Database Links

KEGG: cgb:cg2405

STRING: 196627.cg2405

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the role of cytochrome c subunit (qcrC) in Corynebacterium glutamicum's respiratory chain?

The cytochrome c subunit (qcrC) is a critical component of the menaquinol-cytochrome c reductase complex in C. glutamicum's respiratory chain. It functions within the cytochrome bc1 complex, which forms a supercomplex with the cytochrome aa3 oxidase. This bc1-aa3 supercomplex transfers reducing equivalents from menaquinol to oxygen, serving as one of two terminal electron transfer pathways in C. glutamicum (alongside the cytochrome bd oxidase pathway) . The qcrC component contains a unique diheme cytochrome c1, which is the only c-type cytochrome encoded in the C. glutamicum genome . This diheme structure is essential for the electron transfer function, with the second heme group likely serving the role that would be performed by a separate cytochrome c in other organisms .

How does the structure of C. glutamicum qcrC differ from cytochrome c subunits in other bacteria?

C. glutamicum possesses a distinctive diheme cytochrome c1 in its qcrC subunit, contrasting with the monoheme cytochrome c1 found in most other bacteria. Mutational analysis has confirmed that both heme groups are essential for the activity of the bc1-aa3 supercomplex . The second heme group in C. glutamicum's cytochrome c1 has an extra charged amino-acid cluster near the cytochrome c-binding domain of subunit II (CtaC), which was suggested to interact with the second cytochrome c of the cytochrome bc1 complex . This unique arrangement enables C. glutamicum to function without a separate soluble cytochrome c protein, which is typically required for electron transfer between the bc1 complex and terminal oxidases in most other respiratory chains .

What is the significance of the bc1-aa3 supercomplex in C. glutamicum?

The bc1-aa3 supercomplex in C. glutamicum represents a specialized adaptation in its respiratory chain, enabling efficient electron transfer from menaquinol to oxygen. This supercomplex was identified through co-purification of all subunits of the bc1 complex (QcrB, QcrA, and QcrC) and cytochrome aa3 oxidase (CtaD, CtaC, CtaE, and CtaF) via affinity chromatography . The supercomplex is highly energy-efficient, with a proton translocation efficiency three times greater than the alternative cytochrome bd oxidase pathway . This efficiency difference is significant for cellular energy production and has implications for industrial applications, including amino acid production, where energy metabolism directly impacts yield and productivity .

What methods are effective for expressing recombinant qcrC in C. glutamicum?

Expression of recombinant qcrC in C. glutamicum can be achieved through several methodological approaches:

  • Plasmid-based expression systems: Vectors such as pEKEx2, which contains an IPTG-inducible tac promoter, can be used for controlled expression of qcrC genes . The target genes should be amplified using PCR with appropriate primers that include restriction sites compatible with the chosen expression vector.

  • Promoter selection: Both inducible and constitutive promoters can be employed for qcrC expression:

    • Inducible promoters like tac or P4-N14 (an auto-inducible system) provide controlled expression

    • Constitutive promoters such as Psod or Ptuf offer continuous expression without requiring induction reagents

  • Optimization of gene sequences: Codon optimization based on C. glutamicum preferences can improve expression levels of recombinant qcrC .

  • Signal sequence selection: For secreted or membrane-targeted versions of qcrC, appropriate signal sequences must be selected to ensure proper localization .

The transformation efficiency in C. glutamicum is considerably lower than in E. coli, requiring careful optimization of electroporation conditions . For recombinant qcrC expression, researchers should consider the growth phase, as protein yield can be significantly affected by the timing of induction and harvest .

How can researchers effectively analyze qcrC function within the respiratory chain of C. glutamicum?

Analyzing qcrC function within the respiratory chain requires a multi-faceted approach:

  • Genetic manipulation: Creating cydAB deletion mutants allows researchers to force electron flow through the bc1-aa3 supercomplex pathway, enabling specific study of qcrC function . This approach revealed that when the cytochrome bd oxidase was deleted, growth after the exponential phase was inhibited, leading to 40% less biomass formation compared to wild type .

  • Rapid kinetic measurements: The function of qcrC can be studied using stopped-flow techniques to measure electron transfer rates. For example, studies have shown rapid electron transfer from the cytochrome bc1-complex to the cytochrome aa3 oxidase via the additional heme c in qcrC, suggesting a functional role as an electron bridge between the two complexes .

  • Comparative oxygen consumption assays: Measuring O2 reduction activities with various electron donors (TMPD/cytochrome c) compared with the activity of the isolated supercomplex versus separated components can reveal the specific contribution of qcrC .

  • Transcriptome analysis: RNA-seq techniques can be employed to understand how qcrC expression changes under various conditions and how these changes correlate with metabolic shifts in C. glutamicum .

What protocols are recommended for purification of recombinant qcrC protein?

Purification of recombinant qcrC from C. glutamicum can be accomplished through the following protocol:

  • Affinity tag selection: Introducing a Strep-tag to either QcrB (cytochrome b) or CtaD (subunit I) allows for co-purification of the entire bc1-aa3 supercomplex, including qcrC .

  • Cell disruption and membrane isolation: Cells should be disrupted by methods such as French press or sonication in an appropriate buffer system (typically phosphate buffer with glycerol and protease inhibitors).

  • Membrane protein solubilization: The membrane fraction containing qcrC must be solubilized using suitable detergents like n-dodecyl-β-D-maltoside at concentrations determined through optimization experiments.

  • Chromatography steps:

    • Initial capture using affinity chromatography (Strep-Tactin for Strep-tagged proteins)

    • Further purification using ion exchange chromatography

    • Final polishing with size exclusion chromatography

  • Activity verification: Purified qcrC functionality should be verified through spectroscopic analysis of heme content and electron transfer activity assays using artificial electron donors/acceptors.

The purification process must maintain the protein's native conformation, particularly preserving the integrity of both heme groups which are essential for function .

How does qcrC expression impact energy metabolism and amino acid production in C. glutamicum?

The expression level of qcrC has significant implications for cellular energy metabolism and industrial amino acid production in C. glutamicum:

Respiratory Chain StatusImpact on GrowthImpact on Lysine ProductionProposed Mechanism
Wild-typeNormal growth patternBaseline productionBalanced electron flow through both pathways
cydAB deletion (forcing flow through bc1-aa3)40% reduction in biomass+12% increase in lysineEnhanced energy efficiency through the more efficient bc1-aa3 pathway
Overexpression of cytochrome bd45% reduction in growth rate, 35% reduction in biomassNot reportedInefficient electron flow through cytochrome bd pathway

In the lysine-producing strain MH20-22B, deletion of cydAB genes had minor effects on growth but increased lysine production by approximately 12% . This finding demonstrates that redirecting electron flow through the more energy-efficient bc1-aa3 supercomplex, which includes qcrC, can enhance amino acid production yields. Researchers can utilize this relationship between respiratory chain efficiency and product formation to design metabolic engineering strategies that favor amino acid production .

What are the challenges in maintaining proper folding and heme incorporation when expressing recombinant qcrC?

Expression of functional recombinant qcrC presents several challenges related to proper folding and heme incorporation:

  • Heme biosynthesis and incorporation: As a diheme protein, qcrC requires appropriate heme synthesis, transport, and incorporation machinery. Researchers must ensure sufficient heme availability in the expression host, potentially by co-expressing or upregulating heme biosynthesis genes.

  • Membrane integration: Since qcrC is part of a membrane-bound complex, proper membrane targeting and integration are essential. Selection of appropriate signal sequences and consideration of membrane composition in the expression host are critical factors.

  • Protein folding factors: Chaperones specific to C. glutamicum may be required for proper folding of qcrC. When expressing in heterologous hosts, co-expression of these chaperones might be necessary.

  • Supercomplex assembly: For full functionality, qcrC must correctly assemble with other components of the bc1-aa3 supercomplex. Expression studies should consider whether to express individual components or the entire complex.

  • Post-translational modifications: Any required post-translational modifications specific to C. glutamicum must be accounted for in the expression system design.

To address these challenges, researchers should consider using C. glutamicum itself as the expression host when possible, as it naturally possesses all the required machinery for proper qcrC folding and function .

How can recombineering techniques be applied to modify qcrC for enhanced function or study?

Advanced recombineering techniques can be applied to modify qcrC for both functional studies and potential enhancement:

  • RecET-based recombineering: This system, adapted from E. coli phage, has been demonstrated to work effectively in C. glutamicum. For qcrC modifications, researchers can use the exonuclease-recombinase pair RecET for recombination with linear double-stranded DNA (dsDNA) . Optimization studies showed that homology arm lengths of 800 bp provide optimal recombination frequency in C. glutamicum .

  • Markerless deletion system: A self-excisable linear dsDNA cassette containing the Cre/loxP system allows for markerless modifications of qcrC, enabling precise genetic changes without permanent marker integration .

  • Site-directed mutagenesis approaches: For studying specific amino acid residues in qcrC, particularly those involved in heme binding or electron transfer, researchers can design specific mutations using PCR-based site-directed mutagenesis combined with RecET recombineering.

  • Introduction of reporter tags: Fluorescent or affinity tags can be introduced to study qcrC localization, expression levels, or to facilitate purification without disrupting function.

  • Optogenetic control systems: Recently developed optogenetic tools for C. glutamicum, such as the 'LightOn C.glu' system, can be adapted to achieve light-controlled expression of qcrC variants, allowing precise temporal control over expression for functional studies .

When applying these techniques, researchers should verify that modifications don't disrupt the essential dual-heme functionality of qcrC by measuring electron transfer rates and respiratory activity .

How does qcrC function relate to copper metabolism in C. glutamicum?

The relationship between qcrC function and copper metabolism in C. glutamicum is significant because:

  • Copper requirements: While qcrC itself is a heme-containing protein, the cytochrome aa3 oxidase component of the bc1-aa3 supercomplex requires copper as a cofactor. Copper limitation affects the function of the entire respiratory chain, including electron transfer through qcrC .

  • Copper deprivation response: Under copper-limited conditions, C. glutamicum undergoes transcriptional changes that affect the expression of respiratory chain components. Studies have established specific copper-deprivation conditions and analyzed their influence on growth and metabolism .

  • Alternative pathway expression: Copper limitation may trigger increased expression of the alternative cytochrome bd oxidase pathway, which does not require copper, potentially reducing electron flow through the qcrC-containing bc1-aa3 supercomplex .

What insights can transcriptome analysis provide about qcrC expression under different physiological conditions?

Transcriptome analysis can offer valuable insights into qcrC expression patterns:

  • Growth phase-dependent expression: RNA-seq studies have shown that the expression of respiratory chain components, including qcrC, can vary significantly depending on growth phase. This information helps researchers determine optimal timing for studies or recombinant protein production .

  • Response to environmental stressors: Transcriptome analysis reveals how qcrC expression changes in response to environmental factors such as oxygen availability, nutrient limitation, or exposure to antibiotics .

  • Impact of heterologous protein expression: Studies comparing wild-type C. glutamicum with strains expressing recombinant proteins have demonstrated that foreign protein expression can significantly affect the transcription of native genes, including those involved in energy metabolism and respiratory chain components like qcrC .

  • Identification of co-regulated genes: Transcriptome data can reveal genes whose expression patterns correlate with qcrC, potentially identifying new functional relationships or regulatory networks .

  • Validation approach: To confirm transcriptome findings, quantitative reverse transcription-PCR (qRT-PCR) can be used as demonstrated in research on C. glutamicum gene expression, where the 16S rRNA was used as an endogenous reference gene .

How might CRISPR/Cpf1 tools be applied to study qcrC function in C. glutamicum?

The application of CRISPR/Cpf1 technology offers promising approaches for studying qcrC function:

  • Light-controlled gene interference: Recent developments in light-controlled CRISPR/Cpf1 systems for C. glutamicum provide unprecedented precision in controlling gene expression . This technology could enable researchers to create conditional qcrC knockdowns, where expression can be modulated by light exposure at specific growth phases.

  • Precise genome editing: CRISPR/Cpf1 systems allow for more precise genetic modifications than traditional methods, enabling researchers to create point mutations, insertions, or deletions in qcrC without disrupting surrounding genetic elements .

  • Multiplexed gene regulation: The CRISPR/Cpf1 system can be designed to target multiple genes simultaneously, allowing researchers to study the effects of combined modifications in qcrC and other respiratory chain components.

  • Dynamic regulation studies: By combining light-controlled CRISPR/Cpf1 with advanced bioreactor systems, researchers can investigate the effects of dynamic qcrC expression patterns on growth, respiration efficiency, and metabolite production in real-time .

These advanced genetic tools could significantly enhance our understanding of qcrC function by enabling more sophisticated experimental designs than previously possible with traditional genetic manipulation techniques.

What potential applications exist for engineered qcrC variants in biotechnology?

Engineered variants of qcrC could have several biotechnological applications:

  • Enhanced amino acid production: Since modulation of respiratory chain efficiency affects amino acid production (as demonstrated by the 12% increase in lysine production in cydAB deletion strains), engineered qcrC variants with optimized electron transfer properties could further improve production yields .

  • Improved recombinant protein expression: Engineering the respiratory chain to enhance energy efficiency could provide more resources for recombinant protein production, potentially addressing the lower protein yields sometimes observed in C. glutamicum compared to E. coli .

  • Biosensor development: Modified qcrC could potentially be developed as a biosensor component for detecting changes in cellular redox state or specific metabolites that interact with the respiratory chain.

  • Optimized biocatalysis: For whole-cell biocatalysis applications using C. glutamicum, engineered qcrC variants could help optimize cellular energy production to support specific catalytic processes.

  • Bioremediation applications: Modified respiratory chains could potentially enhance the ability of C. glutamicum to grow under specific environmental conditions, making it more suitable for certain bioremediation applications.

These applications represent emerging areas where fundamental research on qcrC structure and function could translate into biotechnological innovations with industrial relevance.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.