Recombinant Corynebacterium glutamicum Menaquinol-cytochrome c reductase iron-sulfur subunit (qcrA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
qcrA; Cgl2190; cg2404; Cytochrome bc1 complex Rieske iron-sulfur subunit; Cytochrome bc1 reductase complex subunit QcrA; Menaquinol--cytochrome c reductase iron-sulfur subunit; Rieske iron-sulfur protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-408
Protein Length
full length protein
Species
Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025)
Target Names
qcrA
Target Protein Sequence
MSNNNDKQYTTQELNAMSNEDLARLGTELDDVTIAYRKERFPIANDPAEKRAARAVTFWL VLGIIGGLGFLATYIFWPWEYKAHGDEGLLAYTLYTPMLGITSGLCILSLGFAVVLYVKK FIPEEIAVQRRHDGPSEEVDRRTIVALLNDSWQTSTLGRRKLIMGLAGGGAVLAGLTIIA PMGGMIKNPWNPKEGPMDVQGDGTLWTSGWTLVENDVKVYLGRDTAAIAESHTDATGEHW STTGVSRLVRMRPEDLAAASMETVFPLPAEMVNDGAEYDPAKDVYEHQMHSVHGPRNAVM LIRLRTADAEKVIEREGQESFHYGDYYAYSKICTHIGCPTSLYEAQTNRILCPCHQSQFD ALHYGKPVFGPAARALPQLPITVDEEGYLIAAGNFIEPLGPAFWERKS
Uniprot No.

Target Background

Function

The iron-sulfur subunit of the cytochrome bc1 complex is a crucial component of the respiratory electron transport chain, essential for ATP synthesis. This complex catalyzes the oxidation of menaquinol and the reduction of cytochrome c within the respiratory chain, utilizing a Q-cycle mechanism to couple electron transfer with proton gradient generation, driving ATP synthesis.

Database Links

KEGG: cgb:cg2404

STRING: 196627.cg2404

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Corynebacterium glutamicum Menaquinol-cytochrome c reductase iron-sulfur subunit (qcrA)?

The qcrA protein is a Rieske iron-sulfur protein that functions as a critical component of the menaquinol:cytochrome c oxidoreductase complex in Corynebacterium glutamicum. This protein contains iron-sulfur clusters that facilitate electron transfer within the respiratory chain of this Gram-positive bacterium. QcrA serves as the iron-sulfur subunit of this complex, working in conjunction with other subunits to catalyze electron transfer from menaquinol to cytochrome c. The protein is essential for aerobic respiration and energy generation in C. glutamicum .

What is the structural composition of the menaquinol:cytochrome c oxidoreductase complex?

The menaquinol:cytochrome c oxidoreductase complex (also known as the bc complex or b6c complex) is a trimeric structure with a specific subunit composition. The complete functional complex consists of three distinct protein subunits: QcrA (the iron-sulfur subunit), QcrB (the cytochrome b subunit), and QcrC (the cytochrome cc subunit). This can be represented as:

menaquinol:cytochrome c oxidoreductase = [(QcrC)(QcrB)(QcrA)]

Each subunit has specific functional characteristics:

  • QcrA: Rieske iron-sulfur protein that facilitates electron transport

  • QcrB: Homologous to photosynthetic b6 complex cytochromes and contains a heme covalently bound to Cys 43

  • QcrC: Cytochrome cc subunit that completes the complex

What is the role of qcrA in the respiratory chain of Gram-positive bacteria?

In Gram-positive bacteria like Corynebacterium glutamicum and Bacillus subtilis, qcrA serves as a critical component in the aerobic respiratory chain located in the cytoplasmic membrane. The respiratory chain in these organisms branches at menaquinol, which can transfer electrons to oxygen through four different routes involving different terminal oxidases.

QcrA participates in the branch that involves:

  • Menaquinol:cytochrome c oxidoreductase (bc complex)

  • Cytochrome c550 or cytochrome c551

  • caa3-type cytochrome

In this pathway, qcrA facilitates electron transfer from menaquinol to cytochrome c, which is an essential step in aerobic energy generation. Unlike many other organisms, Gram-positive bacteria like B. subtilis do not have freely soluble c-type cytochromes but instead have membrane-anchored c-type cytochromes (c550 and c551) .

What experimental approaches can be used to study the interaction between qcrA and other components of the respiratory chain?

Studying the interactions between qcrA and other respiratory chain components requires a multi-faceted approach that combines biochemical, biophysical, and genetic techniques.

TechniqueApplicationData OutputAdvantages
Co-immunoprecipitationProtein-protein interactionsBinding partnersIdentifies physiological interactions
Förster Resonance Energy Transfer (FRET)Real-time monitoring of interactionsEnergy transfer efficiencyProvides spatial information (1-10 nm)
Surface Plasmon ResonanceBinding kineticsKa, Kd valuesQuantitative binding parameters
Cross-linking Mass SpectrometryInterface mappingPeptide identificationIdentifies interaction sites
Bacterial Two-Hybrid AssaysIn vivo interactionsReporter gene activityTests interactions in cellular context

When designing these experiments, researchers should consider using site-directed mutagenesis to create specific alterations in the qcrA protein to identify critical residues involved in interactions with QcrB and QcrC. Additionally, reconstitution studies using purified components can provide insights into the minimal requirements for complex formation and electron transfer activity .

How do mutations in the qcrA gene affect respiratory chain function?

Mutations in the qcrA gene can have profound effects on respiratory chain function, particularly affecting electron transfer efficiency and energy generation. The impacts vary depending on the nature and location of the mutation within the protein structure.

Mutations affecting the Rieske iron-sulfur cluster coordination sites (typically involving conserved cysteine and histidine residues) can compromise the redox potential of the cluster, leading to inefficient electron transfer. This is particularly critical since QcrA contains a [2Fe-2S] cluster that serves as an electron carrier.

Research approaches to study these effects include:

  • Site-directed mutagenesis of conserved residues, followed by functional assays

  • Measurement of growth rates under aerobic conditions for mutant strains

  • Direct measurement of electron transfer rates using spectroscopic methods

  • Assessment of the assembly of the bc complex in mutant strains using blue native PAGE

  • Analysis of membrane potential in mutant versus wild-type strains

When analyzing such mutations, researchers should assess both the direct effects on qcrA function and the broader impacts on respiratory chain branching, as disruptions may lead to compensatory upregulation of alternative respiratory pathways .

What are the comparative functional differences between qcrA in Corynebacterium glutamicum versus other bacterial species?

Comparative analysis of qcrA across bacterial species reveals important structural and functional variations that reflect evolutionary adaptations to different metabolic requirements and environmental niches. While the core function of qcrA as an iron-sulfur protein within the bc complex is conserved, notable differences exist.

In Corynebacterium glutamicum, qcrA is part of a menaquinol:cytochrome c oxidoreductase system adapted to the specific membrane composition and energy requirements of this organism. This differs from the well-characterized mitochondrial complex III (ubiquinol:cytochrome c oxidoreductase) in several aspects:

  • C. glutamicum utilizes menaquinol rather than ubiquinol as an electron donor

  • The subunit composition of the complex differs from mitochondrial complex III

  • The arrangement of transmembrane helices and cofactors shows species-specific variations

When conducting comparative studies, researchers should:

  • Perform sequence alignments to identify conserved and variable regions

  • Create phylogenetic trees to understand evolutionary relationships

  • Compare 3D structural models to identify functional adaptations

  • Assess the redox potentials of the iron-sulfur clusters in different species

  • Evaluate the kinetic parameters of electron transfer to identify catalytic efficiency differences

What protocols are recommended for purification of recombinant qcrA?

Purification of recombinant Corynebacterium glutamicum qcrA requires careful consideration of the protein's characteristics, particularly its iron-sulfur cluster and membrane association. The following protocol outlines a recommended approach:

  • Expression System Selection: E. coli BL21(DE3) with a vector containing a T7 promoter and affinity tag (His6 or GST) fused to either N- or C-terminus of qcrA

  • Growth Conditions:

    • Medium: TB or M9 supplemented with iron (100 μM FeCl3) and sulfur

    • Temperature: Initial growth at 37°C to OD600 0.6-0.8, then induction at 18-20°C

    • Inducer: 0.1-0.5 mM IPTG

    • Duration: 16-20 hours post-induction

  • Cell Harvesting and Lysis:

    • Buffer: 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, 1 mM DTT

    • Lysis method: Sonication or French press

    • Additives: Protease inhibitor cocktail, DNase I

  • Purification Steps:

    • Initial capture: Immobilized metal affinity chromatography (IMAC)

    • Intermediate purification: Ion exchange chromatography

    • Polishing: Size exclusion chromatography

    • Buffer for final storage: 25 mM HEPES pH 7.5, 150 mM NaCl, 10% glycerol, 1 mM DTT

  • Quality Control Assessments:

    • SDS-PAGE for purity

    • UV-visible spectroscopy for iron-sulfur cluster integrity

    • Mass spectrometry for identity confirmation

    • Dynamic light scattering for homogeneity

Researchers should note that maintaining reducing conditions throughout purification is crucial for preserving the integrity of the iron-sulfur cluster. The addition of low concentrations of DTT or β-mercaptoethanol in all buffers is recommended. For structural studies requiring higher purity, additional chromatographic steps may be necessary .

What spectroscopic methods are most effective for characterizing the iron-sulfur cluster in qcrA?

Characterization of the iron-sulfur cluster in qcrA requires specialized spectroscopic techniques that can provide information about its electronic structure, oxidation state, and local environment. The following methods are particularly valuable:

Spectroscopic MethodInformation ProvidedExperimental ConsiderationsData Interpretation
UV-visible SpectroscopyOxidation state changes, cluster integritySimple, rapid screening methodCharacteristic absorption bands at ~330, 420, and 550 nm
Electron Paramagnetic Resonance (EPR)Paramagnetic species detection, oxidation statesRequires low temperatures (liquid N2 or He)g-values characteristic of [2Fe-2S] clusters
Mössbauer SpectroscopyIron oxidation states, cluster typeRequires 57Fe enrichmentIsomer shift and quadrupole splitting parameters
Circular Dichroism (CD)Cluster environment, protein foldingSensitive to protein concentrationCharacteristic CD bands in visible region
Resonance Raman SpectroscopyFe-S bond strengths, cluster distortionRequires laser excitation in resonanceVibrational modes of Fe-S bonds
X-ray Absorption SpectroscopyLocal structure around Fe atomsRequires synchrotron radiationXANES for oxidation state, EXAFS for distances

When conducting spectroscopic analyses, it's essential to maintain the protein in an oxygen-free environment to prevent cluster degradation. Comparative studies with known iron-sulfur proteins can serve as valuable references for data interpretation. For comprehensive characterization, researchers should combine multiple spectroscopic techniques to obtain complementary information about the cluster properties .

How can researchers quantitatively assess electron transfer rates in the menaquinol:cytochrome c oxidoreductase complex?

Quantitative assessment of electron transfer rates in the menaquinol:cytochrome c oxidoreductase complex requires specialized techniques that can monitor rapid redox reactions. The following methodologies are particularly useful:

  • Stopped-Flow Spectroscopy:

    • Principle: Rapid mixing of enzyme and substrate followed by time-resolved spectroscopic detection

    • Measurement: Changes in absorbance at wavelengths specific to redox centers (e.g., 550 nm for cytochrome c)

    • Data analysis: Fitting to appropriate kinetic models (e.g., single or multi-exponential)

    • Time resolution: Millisecond range

  • Potentiometric Titrations:

    • Principle: Measurement of redox potential of individual components

    • Approach: Stepwise reduction or oxidation coupled with spectroscopic monitoring

    • Output: Midpoint potentials (Em) for each redox center

    • Analysis: Nernst equation fitting to determine n value (number of electrons)

  • Pulse Radiolysis:

    • Principle: Generation of reducing or oxidizing species by radiation pulse

    • Time resolution: Microsecond to nanosecond range

    • Application: Direct measurement of elementary electron transfer steps

    • Advantage: Can isolate specific electron transfer steps

  • Protein Film Voltammetry:

    • Principle: Immobilization of protein on electrode surface

    • Measurement: Current as function of applied potential

    • Output: Catalytic currents proportional to turnover frequency

    • Analysis: Tafel plots to determine rate-limiting steps

When designing experiments to measure electron transfer rates, researchers should consider:

  • Temperature dependence to determine activation energies

  • pH dependence to identify proton-coupled electron transfer

  • Substrate concentration effects to determine kinetic parameters

  • Inhibitor studies to confirm specific pathways

  • Comparison of wild-type and mutant proteins to identify key residues

How should researchers analyze discrepancies in qcrA activity across different experimental conditions?

When confronting discrepancies in qcrA activity measurements across different experimental conditions, researchers should implement a systematic troubleshooting approach combined with rigorous data analysis. Variations may arise from multiple sources including protein preparation, assay conditions, and analytical methods.

Systematic Analysis Framework:

  • Protein Quality Assessment:

    • Verify protein concentration using multiple methods (Bradford, BCA, A280)

    • Confirm iron-sulfur cluster integrity via UV-visible spectroscopy

    • Assess protein homogeneity using SEC-MALS or native PAGE

    • Determine aggregation state via dynamic light scattering

  • Experimental Variables Control:

    • Create a comprehensive table of all variables across experiments

    • Identify and standardize critical parameters (pH, temperature, ionic strength)

    • Implement internal standards for normalization

    • Perform time-course experiments to identify stability issues

  • Statistical Approach:

    • Apply appropriate statistical tests (ANOVA, t-tests) to determine significance

    • Calculate coefficient of variation (CV) for replicate measurements

    • Implement outlier detection methods (Grubbs' test, Dixon's Q test)

    • Perform power analysis to determine required sample size

  • Validation Strategies:

    • Use alternative assay methods to cross-validate results

    • Test activity with known modulators or inhibitors

    • Compare results with published literature values

    • Conduct experiments with positive controls (well-characterized iron-sulfur proteins)

When presenting discrepant results, researchers should use tables that clearly display all relevant experimental conditions alongside the measured activities, as exemplified in the following format:

Experimental ConditionValue/SettingQcrA Activity (μmol/min/mg)CV (%)n
Buffer composition50 mM HEPES pH 7.542.38.26
Buffer composition50 mM Phosphate pH 7.535.79.16
Temperature25°C42.38.26
Temperature37°C58.67.56
Menaquinol concentration100 μM42.38.26
Menaquinol concentration200 μM44.17.96

This approach to analyzing discrepancies enhances trustworthiness in qualitative research by providing transparency and demonstrating methodological rigor .

What experimental design considerations are important when studying qcrA function in vivo?

Studying qcrA function in vivo requires careful experimental design that accounts for the complexity of cellular systems while maintaining scientific rigor. Researchers should consider both general experimental design principles and specific factors relevant to qcrA function.

Key Experimental Design Considerations:

When designing in vivo experiments, researchers should be mindful of the complex interplay between qcrA function and other cellular processes. The respiratory chain represents a highly integrated system, and perturbations may trigger compensatory mechanisms that complicate interpretation .

What are the emerging techniques for studying the dynamics of qcrA within respiratory chain complexes?

Recent advances in biophysical and structural biology techniques are transforming our understanding of qcrA dynamics within respiratory chain complexes. These emerging approaches provide unprecedented insights into the conformational changes, protein-protein interactions, and electron transfer mechanisms.

Cutting-Edge Techniques for Studying QcrA Dynamics:

  • Cryo-Electron Microscopy (Cryo-EM):

    • Enables visualization of the entire menaquinol:cytochrome c oxidoreductase complex

    • Captures different conformational states during the catalytic cycle

    • Resolves the spatial arrangement of qcrA relative to other subunits

    • Reveals potential interaction interfaces between subunits

  • Single-Molecule FRET:

    • Monitors real-time conformational changes during electron transfer

    • Provides distance measurements between strategically placed fluorophores

    • Captures transient states not observable in ensemble measurements

    • Enables correlation of structural dynamics with functional states

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

    • Maps regions of qcrA that undergo conformational changes during catalysis

    • Identifies solvent-exposed surfaces that may participate in protein-protein interactions

    • Provides information on protein dynamics at peptide-level resolution

    • Complements static structural data from crystallography or cryo-EM

  • Molecular Dynamics Simulations:

    • Models the dynamic behavior of qcrA in a membrane environment

    • Simulates electron transfer pathways through the protein

    • Predicts conformational changes associated with redox state transitions

    • Generates testable hypotheses about residues critical for function

  • Integrative Structural Biology Approaches:

    • Combines multiple experimental techniques (crystallography, NMR, SAXS, etc.)

    • Creates comprehensive models incorporating data at different resolutions

    • Captures both static and dynamic aspects of qcrA function

    • Provides context for interpreting functional studies

When implementing these advanced techniques, researchers should consider:

  • The need for specialized equipment and expertise

  • Sample preparation requirements specific to each method

  • Appropriate controls to validate observations

  • Computational resources required for data analysis

  • Integration of multiple data types for comprehensive understanding

What are the most significant unresolved questions regarding qcrA function and structure?

Despite significant advances in our understanding of qcrA and its role in the menaquinol:cytochrome c oxidoreductase complex, several critical questions remain unresolved. These knowledge gaps represent important opportunities for future research.

Key Unresolved Questions:

  • Structural Dynamics:

    • How do conformational changes in qcrA facilitate electron transfer?

    • What is the precise mechanism of interaction between qcrA and its redox partners?

    • How does the protein environment tune the redox potential of the iron-sulfur cluster?

    • What structural features determine the specificity for menaquinol versus other quinones?

  • Regulatory Mechanisms:

    • How is qcrA expression regulated in response to environmental conditions?

    • Are there post-translational modifications that modulate qcrA activity?

    • What protein-protein interactions beyond the core complex influence qcrA function?

    • How is assembly of the iron-sulfur cluster coordinated with protein folding?

  • Evolutionary Aspects:

    • What evolutionary pressures shaped the specific characteristics of qcrA in C. glutamicum?

    • How does qcrA functional diversity across bacterial species relate to metabolic adaptations?

    • What is the evolutionary relationship between bacterial qcrA and homologous proteins in mitochondria?

    • Are there functional analogs in organisms that lack canonical qcrA?

  • Biotechnological Applications:

    • Can engineered variants of qcrA enhance respiratory efficiency for biotechnological applications?

    • How might qcrA manipulation contribute to metabolic engineering of C. glutamicum?

    • Could qcrA serve as a target for novel antimicrobials against pathogenic relatives of C. glutamicum?

    • What role might qcrA play in bioelectrochemical systems?

Addressing these questions will require interdisciplinary approaches combining structural biology, biochemistry, biophysics, genetics, and systems biology. The integration of emerging technologies with established methodologies will be essential for making significant advances in our understanding of this important respiratory chain component .

How can understanding qcrA function contribute to broader research in bacterial bioenergetics?

Research on Corynebacterium glutamicum qcrA extends beyond this specific protein and organism, providing valuable insights into fundamental principles of bacterial bioenergetics and potential applications in biotechnology, medicine, and environmental science.

Broader Implications of QcrA Research:

  • Fundamental Bioenergetic Principles:

    • QcrA studies illuminate electron transfer mechanisms applicable across diverse respiratory systems

    • The structure-function relationship of qcrA's iron-sulfur cluster provides insights into biological redox chemistry

    • Understanding branched respiratory chains helps elucidate bacterial metabolic flexibility

    • QcrA research contributes to models of proton-coupled electron transfer in biological systems

  • Biotechnological Applications:

    • Knowledge of qcrA function can inform metabolic engineering of C. glutamicum for enhanced amino acid production

    • Understanding respiratory chain efficiency can guide strategies to improve cellular ATP yield

    • QcrA engineering might enable creation of strains with optimized growth characteristics

    • Insights into electron transfer could contribute to development of biological electron transfer devices

  • Medical Relevance:

    • QcrA homologs in pathogenic Corynebacterium species and related Actinobacteria represent potential drug targets

    • Understanding respiratory chain adaptation informs bacterial responses to host environments

    • Comparative studies may reveal species-specific vulnerabilities in respiratory chains

    • QcrA research contributes to fundamental understanding of bacterial metabolism during infection

  • Environmental Applications:

    • Knowledge of qcrA function informs understanding of bacterial adaptation to different oxygen tensions

    • Insights into respiratory chain diversity help explain bacterial niche adaptation

    • Understanding of electron transfer systems supports development of microbial fuel cells

    • QcrA research contributes to models of bacterial energy conservation in varied environments

By positioning qcrA research within this broader context, researchers can identify connections to other fields and recognize how their specific studies contribute to addressing larger scientific questions. This perspective not only enhances the impact of qcrA research but also facilitates interdisciplinary collaboration and application of findings beyond the immediate research focus .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.