Recombinant Corynebacterium glutamicum Uncharacterized membrane protein Cgl2017/cg2211 (Cgl2017, cg2211)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
Cgl2017; cg2211; Uncharacterized membrane protein Cgl2017/cg2211; P20
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-147
Protein Length
full length protein
Species
Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025)
Target Names
Cgl2017
Target Protein Sequence
MAGSSHTIEPEIYRGVSTLDEPSAAWGWHGLKRNTIQLAGWISVLFMLGYNFGNHKGHVE TIWLLVITALLVIGLLIHLFEPKLSQVRTITSRNKPVGHVEPDWTYDQATLTGTWGNLTD SQLRSVNIEPSRVAHLRAADSAKELDN
Uniprot No.

Target Background

Database Links

KEGG: cgb:cg2211

STRING: 196627.cg2211

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Corynebacterium glutamicum and why is it significant for protein expression?

Corynebacterium glutamicum is a Gram-positive, non-pathogenic soil bacterium widely used as a production host for various proteins, including bacteriocins. It has gained significant attention in biotechnology due to its generally recognized as safe (GRAS) status and several advantageous characteristics. One key advantage is its reported minimal extracellular protease activity, which makes it particularly suitable for heterologous protein production where protein degradation is a concern . C. glutamicum has been established as an effective host for the production of various compounds, including amino acids and recombinant proteins, with strains like ATCC13032 and ATCC14067 being commonly used in research settings .

What is the membrane protein Cgl2017/cg2211 and what is its known function?

The membrane protein Cgl2017/cg2211 is an uncharacterized protein found in Corynebacterium glutamicum. Based on available data, this protein is a component of the III2-IV2 respiratory supercomplex in C. glutamicum . Though classified as "uncharacterized," functional annotations suggest it plays a role in the respiratory electron transport chain and oxidative phosphorylation processes . The protein belongs to the DUF2631 family (Domain of Unknown Function 2631), which indicates that its precise molecular function is still not fully understood despite its structural characterization .

How does the respiratory supercomplex in C. glutamicum differ from those in other bacteria?

The III2-IV2 respiratory supercomplex in C. glutamicum represents a specific assembly of respiratory chain components that differs from complexes found in many other bacteria. This supercomplex contains cytochrome components and is involved in electron transport coupled proton transport . Unlike some other bacterial species, C. glutamicum's respiratory machinery includes this particular uncharacterized protein (Cgl2017/cg2211) as an integral component. The structure has been determined through cryo-electron microscopy (cryo-EM), which has revealed its arrangement and potential functional domains . This supercomplex is particularly significant because understanding its structure and function provides insights into the unique aspects of energy metabolism in Actinobacteria compared to other bacterial groups.

What recombineering techniques are most effective for genetic manipulation of the cg2211 gene in C. glutamicum?

For effective genetic manipulation of the cg2211 gene in C. glutamicum, the RecET recombineering system has demonstrated significant success. This system employs the exonuclease-recombinase pair RecE and RecT to facilitate homologous recombination with linear DNA fragments . Based on research findings, the optimization of homology arm length significantly impacts recombination efficiency, with 800 bp appearing to be the optimal length for C. glutamicum ATCC14067 . Beyond this length, there is no significant increase or even a decrease in recombination frequency.

For markerless deletion or modification of the cg2211 gene, a self-excisable linear double-stranded DNA cassette containing the Cre/loxP system can be employed. This approach allows for the removal of selection markers after successful recombination, which is particularly useful for sequential genetic modifications . The process involves:

  • Designing homology arms targeting the cg2211 genomic region

  • Transformation of C. glutamicum expressing RecET proteins with the linear self-excisable dsDNA cassette

  • Selection of recombinants

  • Induction of Cre recombinase (e.g., with 1 mM theophylline) to excise the selection marker between lox71 and lox66 sites

This methodology provides a clean genetic background for subsequent manipulations without marker interference .

How can heterologous expression of Cgl2017/cg2211 be optimized to overcome membrane protein production challenges?

Optimizing heterologous expression of membrane proteins like Cgl2017/cg2211 requires addressing several challenges specific to membrane protein production:

Secretion System Selection: Using the Sec translocon has proven effective for membrane protein secretion in C. glutamicum. This approach can achieve significant protein titers, as demonstrated with other proteins like bacteriocins (e.g., garvicin Q reached approximately 100 mg L⁻¹ using optimized conditions) .

Addressing Proteolytic Degradation: While C. glutamicum has traditionally been considered to have little extracellular protease activity, recent research has identified HtrA as a protease associated with secretion stress that could potentially limit membrane protein production. Using HtrA-deficient strains like C. glutamicum K9 can significantly improve protein yields . In one documented case with a different protein, this approach improved yields from 15 mg L⁻¹ to close to 40 mg L⁻¹ .

Media Optimization: The composition of the cultivation medium significantly impacts membrane protein production. Minimal medium supplemented with specific additives like CaCl₂ and Tween 80 has been shown to reduce protein adsorption to the cell envelope and improve protein availability in culture supernatants .

Cultivation Conditions: Low aeration conditions can prevent activity loss of certain proteins at later cultivation timepoints. This approach has been demonstrated to improve protein titers by approximately 50-fold compared to standard conditions in some cases .

Polymer Encapsulation: For functional studies of membrane proteins like Cgl2017/cg2211, employing polymer encapsulation methods such as styrene-maleic acid lipid particles (SMALPs) can provide a more native-like environment compared to traditional detergent solubilization approaches .

What structural characteristics of the III2-IV2 respiratory supercomplex influence the functional role of Cgl2017/cg2211?

The structural characteristics of the III2-IV2 respiratory supercomplex from C. glutamicum have been elucidated through cryo-electron microscopy, providing insights into how Cgl2017/cg2211 may function within this complex. The supercomplex contains multiple components of the electron transport chain, including cytochrome components .

Key structural features that likely influence Cgl2017/cg2211 function include:

  • Membrane Integration: As a membrane protein, Cgl2017/cg2211 contains transmembrane domains that anchor it within the bacterial membrane, positioning it appropriately within the respiratory supercomplex .

  • Protein-Protein Interaction Domains: The arrangement within the supercomplex suggests specific interaction interfaces with other components, particularly cytochrome oxidase subunits and cytochrome bc1 complex components .

  • Potential Metal-Binding Sites: Functional annotations suggest possible iron, copper, and heme binding capabilities, which would be essential for electron transfer functions .

  • Conserved Domains: Despite being classified as "uncharacterized," the protein contains the DUF2631 domain, which may have a conserved but not yet fully understood function in respiratory processes .

What are the most effective methods for solubilizing and purifying the membrane protein Cgl2017/cg2211 while maintaining its native structure?

Effective solubilization and purification of membrane proteins like Cgl2017/cg2211 require specialized approaches to maintain structural integrity. Based on current research on membrane proteins, the following methodologies are recommended:

Polymer-Based Extraction: Styrene-maleic acid (SMA) copolymers offer significant advantages over traditional detergent solubilization. SMA lipid particles (SMALPs) extract membrane proteins along with their surrounding native lipids, preserving a more native-like environment . This approach is particularly valuable for Cgl2017/cg2211 as it maintains the protein in a more functionally relevant state.

Stability Optimization: For biophysical characterization, SMALP-encapsulated proteins demonstrate prolonged stability on sensor chip surfaces and can withstand higher temperatures during assays compared to detergent-solubilized proteins .

Purification Strategy: A recommended purification workflow includes:

  • Cell disruption under mild conditions to preserve membrane integrity

  • Membrane fraction isolation through differential centrifugation

  • Solubilization using SMA copolymers (typically 2-3% w/v) in appropriate buffer conditions

  • Affinity chromatography utilizing engineered tags (if the recombinant protein includes them)

  • Size exclusion chromatography for final purification and buffer exchange

This approach has shown success with other membrane proteins and should be applicable to Cgl2017/cg2211 given its integral membrane nature and association with the respiratory supercomplex .

How can surface plasmon resonance (SPR) be optimized for studying ligand interactions with Cgl2017/cg2211?

Surface plasmon resonance (SPR) analysis of membrane proteins like Cgl2017/cg2211 requires specialized approaches to maintain protein integrity while generating reliable binding data. Based on current research with membrane proteins, the following optimization strategies are recommended:

Polymer Encapsulation: SMALP-encapsulated Cgl2017/cg2211 offers significant advantages for SPR studies compared to detergent-solubilized protein. Benefits include:

  • Prolonged stability on the sensor chip surface

  • Ability to withstand higher assay temperatures

  • Maintenance of a more native-like lipid environment that preserves protein conformation

Immobilization Strategy: For optimal results, several immobilization approaches should be evaluated:

  • Covalent amine coupling if the protein contains accessible lysine residues away from binding sites

  • Capture approaches using engineered affinity tags (His-tag capture via Ni-NTA sensor chips)

  • Biotinylation methods combined with streptavidin sensor chips for oriented immobilization

Buffer Optimization: Buffer composition significantly impacts both protein stability and binding data quality. Recommended starting conditions include:

  • Physiological pH (7.0-7.4)

  • Inclusion of ions relevant to protein function (given the protein's potential metal-binding properties )

  • Low concentrations of stabilizing agents

Control Surfaces: Parallel analysis using proper control surfaces is essential, including:

  • Empty SMALP particles containing only lipids

  • Denatured protein samples

  • Non-related membrane proteins of similar size

This methodological approach builds on established protocols developed through collaborations between protein scientists and SPR experts, as highlighted in current research on membrane protein characterization .

What expression systems and conditions yield the highest functional expression of Cgl2017/cg2211?

Based on research with C. glutamicum and membrane proteins, the following expression systems and conditions are likely to yield the highest functional expression of Cgl2017/cg2211:

Expression Host Selection:

  • C. glutamicum K9 (HtrA-deficient strain) has demonstrated superior results for secreted protein production compared to standard strains

  • This strain addresses secretion stress-related proteolytic degradation concerns

Expression Vector Design:

  • Vectors containing the Sec translocon secretion system components have proven effective

  • Promoter selection is critical: IPTG-inducible promoters like Ptac or constitutive promoters optimized for C. glutamicum should be evaluated

Media Formulation:

  • Minimal medium (such as CGXII) supplemented with:

    • CaCl₂ (helps reduce protein adsorption to cell envelope)

    • Tween 80 (reduces adsorption but monitor potential activity reduction at later timepoints)

Cultivation Parameters:

  • Low aeration conditions to prevent activity loss at later timepoints

  • Temperature optimization: typically 30°C for C. glutamicum

  • Fed-batch cultivation for higher cell densities and protein yields

Induction Strategy:

  • If using inducible systems, optimize inducer concentration (e.g., IPTG) and induction timing

  • Consider dual-phase cultivation: growth phase followed by production phase at reduced temperature

This comprehensive approach has demonstrated success with other challenging membrane and secreted proteins in C. glutamicum, with documented improvements in protein titers from approximately 7 mg L⁻¹ to 100 mg L⁻¹ in optimized systems .

How can researchers distinguish between functional and non-functional forms of recombinant Cgl2017/cg2211?

Distinguishing between functional and non-functional forms of recombinant Cgl2017/cg2211 requires multiple complementary approaches:

Structural Integrity Assessment:

  • Circular Dichroism (CD) Spectroscopy: Analyze secondary structure elements characteristic of properly folded membrane proteins

  • Fluorescence Spectroscopy: If the protein contains tryptophan residues, their emission spectra can indicate proper folding

  • Size Exclusion Chromatography: Properly folded protein should elute at the expected size/shape

Functional Assays (based on predicted respiratory chain functions ):

  • Electron Transfer Activity: Measure electron transfer rates using artificial electron donors/acceptors

  • Oxygen Consumption Assays: When incorporated into membrane systems, functional protein may influence respiratory rates

  • Metal Binding Assays: Test binding of predicted cofactors (iron, copper, heme) using isothermal titration calorimetry or spectroscopic techniques

Membrane Integration Analysis:

  • Proteoliposome Reconstitution: Successful incorporation into artificial membrane systems

  • Membrane Fractionation: Proper localization in membrane fractions when expressed in host cells

  • Protease Protection Assays: Determine correct topology based on accessibility of domains to proteases

Supercomplex Formation:

  • Blue-Native PAGE: Ability to form or integrate into expected protein complexes

  • Co-immunoprecipitation: Interaction with known respiratory chain components

  • Cryo-EM Analysis: Structural integration into the III2-IV2 respiratory supercomplex

These multiple lines of evidence, when combined, provide a comprehensive assessment of protein functionality beyond simple expression and purification.

What approaches can resolve contradictory data when characterizing the structure-function relationship of Cgl2017/cg2211?

When faced with contradictory data in structure-function characterization of Cgl2017/cg2211, researchers should implement a systematic troubleshooting and validation approach:

Methodological Cross-Validation:

  • Employ orthogonal techniques to verify the same parameter (e.g., protein-protein interactions via both SPR and isothermal titration calorimetry)

  • Vary experimental conditions systematically to identify parameter-dependent contradictions

  • Use both in vitro and in vivo approaches to validate findings

Structural Context Consideration:

  • Evaluate the protein both in isolation and within the native supercomplex context

  • Consider different membrane environments that might affect protein conformation and function

  • Analyze the impact of detergents versus polymer encapsulation methods on protein behavior

Mutational Analysis:

  • Generate targeted mutants of key residues to test structure-function hypotheses

  • Employ alanine-scanning mutagenesis across domains with conflicting functional data

  • Create chimeric proteins with related bacterial homologs to identify critical regions

Computational Approaches:

  • Molecular dynamics simulations to predict protein behavior under different conditions

  • Homology modeling based on related proteins with known functions

  • Integration of experimental data with computational predictions to resolve contradictions

Collaboration and Replication:

  • Engage multiple laboratories to independently verify key findings

  • Standardize protocols across research groups

  • Implement blinded analysis of critical data

This structured approach helps identify whether contradictions arise from technical issues, biological variability, or actually represent important insights into protein function under different conditions.

What bioinformatic tools are most effective for predicting functional domains and potential interactions of Cgl2017/cg2211?

For comprehensive bioinformatic analysis of Cgl2017/cg2211, the following integrated approach is recommended:

Sequence-Based Analysis:

  • Multiple Sequence Alignment Tools: MUSCLE or MAFFT for alignment with homologous proteins across bacterial species

  • Domain Prediction: InterProScan to identify known domains beyond DUF2631 , including potential transmembrane regions, signal peptides, and functional motifs

  • Conservation Analysis: ConSurf to map evolutionary conservation onto structural models, highlighting potentially functional residues

Structural Prediction and Analysis:

  • AlphaFold2/RoseTTAFold: Generate accurate structural predictions, particularly valuable for membrane proteins

  • TMHMM/TOPCONS: Predict transmembrane topology and membrane-spanning regions

  • 3DLigandSite/COACH: Identify potential ligand binding sites, particularly for predicted metal ions (iron, copper)

Interaction Prediction:

  • STRING Database: Identify potential protein interaction partners based on genomic context, co-expression, and experimental data

  • PrePPI/PSOPIA: Predict protein-protein interaction sites on the protein surface

  • Molecular Docking: Tools like HADDOCK for modeling interactions with predicted partners in the respiratory supercomplex

Functional Inference:

  • GeneMANIA: Integrate multiple genomics and proteomics datasets to infer function

  • Gene Ontology Analysis: Systematically annotate potential functions based on predicted domains and interactions

  • Pathway Mapping: KEGG/BioCyc to place the protein in metabolic and signaling context

Integration with Experimental Data:

  • Map cryo-EM structural data from the III2-IV2 respiratory supercomplex onto predictions

  • Correlate bioinformatic predictions with mass spectrometry interaction data

  • Use bioinformatic predictions to guide targeted mutagenesis experiments

This multi-layered bioinformatic approach provides a comprehensive framework for generating testable hypotheses about the function of this uncharacterized membrane protein.

How do different genetic manipulation techniques compare for studying Cgl2017/cg2211 function in C. glutamicum?

Different genetic manipulation techniques offer distinct advantages when studying Cgl2017/cg2211 function in C. glutamicum. The following table compares key methodologies:

TechniqueEfficiency in C. glutamicumAdvantagesLimitationsBest Applications
RecET RecombineeringHigh with 800bp homology arms - Markerless deletions possible
- Sequential modifications
- Precise edits
- Requires expression of RecET
- Homology arm optimization
- Strain-specific efficiency
Gene knockout/replacement studies of cg2211
CRISPR-Cas9Moderate (strain-dependent)- Multiplex editing
- Reduced homology requirements
- Higher specificity
- PAM site requirements
- Off-target concerns
- Delivery challenges in C. glutamicum
Precise point mutations and small insertions/deletions
Transposon MutagenesisVariable- High-throughput screening
- No prior sequence knowledge needed
- Genome-wide coverage
- Random insertions
- Polar effects on downstream genes
- Limited precision
Initial functional screening and phenotype association
Allelic Exchange via Suicide VectorsModerate- Well-established protocols
- No specialized protein expression required
- Stable integration
- Two recombination events required
- Time-consuming
- Selection marker complications
Standard gene replacement when precision is less critical
Recombineering with Self-Excisable CassettesHigh - Marker removal post-selection
- Clean genetic background
- Multiple rounds possible
- Multi-step process
- Induction system required
- Potential scar sequences
Sequential modifications of cg2211 and related genes

Based on the available research, RecET recombineering with self-excisable cassettes has demonstrated particularly high efficiency in C. glutamicum ATCC14067 and is well-suited for precise genetic manipulation of the cg2211 gene . The ability to achieve markerless deletions facilitates subsequent genetic manipulations and functional studies without marker interference.

What are the comparative advantages of different membrane protein solubilization methods for studying Cgl2017/cg2211?

Various membrane protein solubilization methods offer distinct advantages for studying Cgl2017/cg2211, particularly when considering the need to maintain native structure and function:

Solubilization MethodLipid RetentionProtein StabilityFunctional PreservationTechnical ComplexityDownstream Applications
Detergent Micelles (Traditional)Low - most native lipids stripped Moderate - often leads to instability Low-Moderate - function often compromisedLow - well-established protocolsGood for crystallography, limited for functional studies
Styrene-Maleic Acid Lipid Particles (SMALPs)High - preserves native lipid environment High - maintains native membrane contextHigh - preserves native interactions and conformationModerate - newer technique with optimized protocolsExcellent for SPR, cryo-EM, functional studies
Nanodiscs (MSP-based)Moderate - controlled lipid compositionHigh - stable disc structureModerate-High - depends on lipid compositionHigh - requires membrane scaffold proteins and optimizationGood for structural studies and controlled lipid environments
AmphipolsLow - requires initial detergent stepHigh - once exchanged into amphipolsModerate - depends on initial solubilizationModerate - requires detergent removalExcellent for cryo-EM, limited for some functional studies
Digitonin SolubilizationModerate - milder than many detergentsModerate-High - gentle extractionModerate-High - often preserves supercomplexesLow - straightforward protocolsGood for initial respiratory supercomplex isolation

For Cgl2017/cg2211, which functions as part of the III2-IV2 respiratory supercomplex , SMALP encapsulation offers significant advantages by maintaining the protein in a more native-like environment with surrounding lipids . This approach is particularly valuable for biophysical characterization methods like SPR, allowing for prolonged stability on sensor chip surfaces and supporting higher temperature assays .

How do different expression systems compare for the production of functional recombinant Cgl2017/cg2211?

Different expression systems offer varying advantages for producing functional Cgl2017/cg2211. The following table compares key systems based on current research:

Expression SystemExpression LevelFunctional YieldMembrane IntegrationPost-translational ModificationsScale-up PotentialKey Considerations
C. glutamicum (Native)ModerateHighNative environmentNative processingGood- Natural host advantage
- Low protease activity
- Established genetic tools
C. glutamicum K9 (HtrA-deficient)HighVery HighNative environmentNative processingGood- Reduced proteolytic degradation
- Improved yields for secreted/membrane proteins
- Up to 50-fold improved yields
E. coliHighLow-ModerateOften problematicLimitedExcellent- Rapid growth and high biomass
- Inclusion body formation common
- Refolding often required
P. pastoris (Yeast)Moderate-HighModerateGood for eukaryotic MPsSome eukaryotic modificationsVery Good- Glycosylation may interfere
- Different membrane composition
- Slower process than bacterial systems
Cell-Free SystemsVariableModerateRequires liposome additionLimitedLimited- Rapid production
- Expensive for scale-up
- Good for initial characterization

Based on available research, C. glutamicum K9 (HtrA-deficient) presents the most promising system for functional production of Cgl2017/cg2211 . This strain addresses secretion stress-related proteolytic degradation issues and has demonstrated significantly improved yields for other proteins (from 7 mg L⁻¹ to ~100 mg L⁻¹ in optimized conditions) .

For optimal results with this system, cultivation in minimal medium supplemented with CaCl₂ and Tween 80 under conditions of low aeration is recommended to prevent activity loss during extended cultivation periods .

What are the most promising research directions for elucidating the function of Cgl2017/cg2211?

The most promising research directions for elucidating the function of the uncharacterized membrane protein Cgl2017/cg2211 involve integrated structural, genetic, and biochemical approaches:

Cryo-EM Structural Analysis: Building on existing structural data of the III2-IV2 respiratory supercomplex , higher-resolution structural studies focused specifically on Cgl2017/cg2211 and its interaction interfaces would provide valuable insights into its precise role within the complex.

Genetic Dissection: Using optimized RecET recombineering techniques to create targeted mutations, domain deletions, and chimeric proteins to systematically identify functional regions of the protein.

Interactome Analysis: Comprehensive identification of protein interaction partners using approaches like proximity labeling (BioID) and cross-linking mass spectrometry to map the protein's position within the respiratory machinery.

Functional Reconstitution: Purification of the protein using SMALP encapsulation followed by reconstitution into proteoliposomes to directly measure electron transfer and other potential activities.

Comparative Genomics: Systematic analysis of homologs across Actinobacteria and other bacterial phyla to identify conserved features that might indicate functional importance.

Metabolic Impact Assessment: Comprehensive metabolomic and fluxomic analysis of wildtype versus cg2211 deletion strains to identify metabolic pathways affected by the protein's absence.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.