Recombinant Corynebacterium glutamicum Uncharacterized protein Cgl1270/cg1434 (Cgl1270, cg1434)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. Please specify your required tag type for preferential development.
Synonyms
Cgl1270; cg1434; Uncharacterized protein Cgl1270/cg1434
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-491
Protein Length
full length protein
Species
Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025)
Target Names
Cgl1270
Target Protein Sequence
MRIIKRRVESAADADTTKNQLAFAGVGVYIAQIVAFFMLAVSAMQAFGFSLAGAAIPATI ASAAIGLGAQSIVADFLAGFFILTEKQFGVGDWVRFEGNGIVVEGTVIEITMRATKIRTI AQETVIIPNSTAKVCINNSNNWSRAVVVIPIPMLGSENITDVIARSEAATRRALGQEKIA PEILGELDVHPATEVTPPTVVGMPWMVTMRFLVQVTAGNQWLVERAIRTEIISEFWEEYG SATTTSGTLIDSLHVEHEEPKTSLIDASPQALKEPKPEAAATVASLAASSNDDADNADAS VINAGNPEKELDSDVLEQELSSEEPEETAKPDHSLRGFFRTDYYPNRWQKILSFGGRVRM STSLLLGALLLLSLFKVMTVEPSENWQNSSGWLSPSTATSTAVTTSETSAPVSTPSMTVP TTVEETPTMESNVETQQETSTPATATPQRADTIEPTEEATSQEETTASQTQSPAVEAPTA VQETVAPTSTP
Uniprot No.

Target Background

Gene References Into Functions
  1. The C-terminal domain structure influences the gating properties of the mechanosensitive channel from Corynebacterium glutamicum. PMID: 26494188
  2. The A-to-V mutation at position 111 (A111V) in the mechanosensitive channel NCgl1221 (MscCG) causes constitutive glutamate secretion in Corynebacterium glutamicum. PMID: 22610427
  3. NCgl1221 is a membrane protein with four transmembrane segments and a cytoplasmic C-terminus. PMID: 19233628
Database Links

KEGG: cgb:cg1434

STRING: 196627.cg1434

Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What expression systems are most effective for producing recombinant Cgl1270/cg1434?

E. coli is the most commonly used expression system for this protein. When expressing Cgl1270/cg1434, researchers should consider these methodological approaches:

  • Vector selection: pET-based vectors with T7 promoter systems have shown high expression efficiency

  • E. coli strain: BL21(DE3) is preferred due to its lack of proteases and compatibility with T7 expression systems

  • Induction parameters: IPTG concentration (typically 0.5-1.0 mM), temperature (18-25°C recommended for membrane proteins), and induction duration (4-16 hours) should be optimized

  • Media composition: Protein expression is typically performed in LB media, but richer media such as 2×YT or TB may increase yield

Verification of expression is routinely performed using SDS-PAGE and Western blotting targeting the His-tag or using Cgl1270/cg1434-specific antibodies if available.

What is the recommended protocol for reconstitution and storage of recombinant Cgl1270/cg1434?

For optimal stability and activity of the recombinant protein, follow these research-validated procedures:

Reconstitution protocol:

  • Centrifuge the vial containing lyophilized protein briefly to collect the powder at the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (50% is standard) to prevent freeze-thaw damage

  • Aliquot to minimize repeated freeze-thaw cycles

Storage guidelines:

  • Long-term storage: -20°C to -80°C in aliquots containing 50% glycerol

  • Working aliquots: 4°C for up to one week

  • Avoid repeated freeze-thaw cycles as they significantly reduce protein activity

  • Reconstituted protein is stored in Tris/PBS-based buffer, with 6% Trehalose, pH 8.0

The half-life of properly stored protein at -80°C is approximately 6-12 months, but functionality should be verified before critical experiments if stored longer than 3 months.

How does Cgl1270/cg1434 fit into genome-scale metabolic models (GEMs) of C. glutamicum?

Cgl1270/cg1434 has been incorporated into advanced genome-scale metabolic models of C. glutamicum, including the recently developed high-quality model iCGB21FR. This model represents an updated and unified GEM of C. glutamicum ATCC 13032 with comprehensive data standards and annotations .

Integration of this uncharacterized protein into GEMs requires:

  • Gene annotation: The gene encoding Cgl1270/cg1434 is included with detailed cross-references

  • Potential reactions: Although uncharacterized, the protein may be assigned to potential metabolic reactions based on sequence homology and structural predictions

  • Gene-protein-reaction (GPR) associations: These connections help establish the protein's role in metabolic networks

  • Systems Biology Ontology (SBO) terms: These provide standardized descriptions of the protein's potential function

The iCGB21FR model includes 1042 metabolites, 1539 reactions, and 805 genes with comprehensive annotations, providing context for understanding potential functions of uncharacterized proteins like Cgl1270/cg1434 .

What computational approaches can predict the function of Cgl1270/cg1434?

Several computational approaches can be employed to predict potential functions:

Sequence-based methods:

  • Homology-based function prediction using BLAST, HHpred, or HMMER

  • Identification of conserved domains using InterProScan or Pfam

  • Transmembrane topology prediction using TMHMM or Phobius

  • Signal peptide prediction using SignalP

Structure-based methods:

  • Protein structure prediction using AlphaFold2 or RoseTTAFold

  • Active site prediction based on structural alignments

  • Ligand binding site prediction using CASTp or COACH

Systems biology approaches:

  • Context-based function prediction using genomic context, protein-protein interactions

  • Gap filling in metabolic models to identify potential functions

  • Flux balance analysis (FBA) simulations with the protein included or knocked out

These methods should be integrated for robust function prediction, with experimental validation of computational hypotheses. Comparing predictions across multiple tools increases confidence in functional annotations .

What experimental approaches are most effective for functional characterization of Cgl1270/cg1434?

A multi-pronged experimental strategy is recommended for characterizing Cgl1270/cg1434:

Genetic approaches:

  • Gene knockout studies to observe phenotypic changes

  • Complementation assays to confirm function

  • Overexpression studies to assess metabolic impact

  • Reporter gene fusions to study expression patterns

Biochemical approaches:

  • Substrate screening using purified protein

  • Enzyme activity assays with predicted substrates

  • Protein-protein interaction studies (pull-downs, cross-linking)

  • Metabolite profiling in knockout vs. wild-type strains

Structural approaches:

  • X-ray crystallography or cryo-EM for structure determination

  • NMR for dynamic structural information

  • Hydrogen-deuterium exchange mass spectrometry for interaction surfaces

Systems biology approaches:

  • Transcriptomics to identify co-expressed genes

  • Proteomics to study abundance under different conditions

  • Metabolomics to detect changes in metabolite levels

  • Flux analysis to quantify metabolic pathway alterations

What are the optimal growth and cultivation conditions for C. glutamicum expressing Cgl1270/cg1434?

C. glutamicum requires specific growth conditions for optimal expression of proteins, including Cgl1270/cg1434:

Media options:

  • Complex media: Lysogeny Broth (LB) supports robust growth

  • Minimal media options:

    • M9 minimal medium

    • CGXII minimal medium (requires supplementation with protocatechuic acid)

Media composition comparison:

ComponentLB MediumM9 Minimal MediumCGXII Minimal Medium
Carbon sourceComplexD-glucoseD-glucose
Nitrogen sourceComplexNH4Cl(NH4)2SO4
SupplementsNone requiredNickel and calcium transporters requiredProtocatechuic acid required
Growth rateHighModerateModerate
Expression levelVariableMore consistentMore consistent

Cultivation parameters:

  • Temperature: 30°C (optimal for C. glutamicum)

  • pH: 7.0-7.4

  • Aeration: Aerobic conditions with vigorous shaking (200-250 rpm)

  • Carbon source: 10 mmol gDW-1 h-1 D-glucose (typical uptake rate)

For anaerobic growth, ensure proper medium supplementation and consider the necessity of the following reactions: catalase reaction (CAT), succinate dehydrogenase (SUCDi), phosphoribosylformylglycinamidine synthase (PRFGS_1), calcium transport (CAt4), fumarate reductase (FRD7), and glycolate transport via proton symport (GLYCLTt2rpp) .

What purification strategies yield the highest purity of recombinant Cgl1270/cg1434?

For high-purity isolation of His-tagged Cgl1270/cg1434, the following purification protocol is recommended:

Cell lysis:

  • Harvest cells by centrifugation (6,000 × g, 15 min, 4°C)

  • Resuspend in lysis buffer (50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10 mM imidazole, protease inhibitors)

  • Disrupt cells using sonication or high-pressure homogenization

  • Clarify lysate by centrifugation (20,000 × g, 30 min, 4°C)

Purification steps:

  • IMAC purification:

    • Load clarified lysate onto Ni-NTA column

    • Wash with 20-30 mM imidazole buffer to remove non-specific binding

    • Elute with 250-300 mM imidazole buffer

    • Monitor purity by SDS-PAGE

  • Size exclusion chromatography:

    • Further purify by gel filtration using Superdex 200 column

    • Buffer: 20 mM Tris-HCl pH 8.0, 150 mM NaCl

  • Final preparation:

    • Pool pure fractions and concentrate

    • Exchange into storage buffer

    • Verify purity (>90%) by SDS-PAGE

For membrane-associated proteins like Cgl1270/cg1434, consider using detergents (0.5-1% DDM or 1% Triton X-100) during extraction and purification to maintain solubility.

How can researchers design knockout experiments to study the function of Cgl1270/cg1434?

Designing effective knockout experiments for Cgl1270/cg1434 requires careful planning:

Knockout strategy design:

  • Selection of knockout method:

    • CRISPR-Cas9 system (most precise)

    • Homologous recombination with antibiotic resistance markers

    • Transposon mutagenesis (for initial screening)

  • Design considerations:

    • Complete gene deletion vs. disruption

    • Potential polar effects on downstream genes

    • Marker selection (kanamycin resistance is commonly used)

Phenotypic characterization protocols:

  • Growth analysis:

    • Compare growth rates in different media (LB, M9, CGXII)

    • Test aerobic and anaerobic conditions

    • Evaluate carbon source utilization profiles

  • Metabolic analysis:

    • Measure amino acid production, especially glutamate

    • Analyze metabolite profiles using LC-MS or GC-MS

    • Perform 13C metabolic flux analysis to identify pathway alterations

  • Transcriptomic response:

    • RNA-seq to identify compensatory changes

    • qRT-PCR for targeted gene expression analysis

  • Complementation studies:

    • Reintroduce wild-type gene to verify phenotype reversal

    • Test mutant variants to identify critical residues

How can researchers integrate Cgl1270/cg1434 data into genome-scale metabolic models?

Integrating experimental data about Cgl1270/cg1434 into GEMs requires a systematic approach:

Integration methodology:

  • Update gene annotation:

    • Add experimentally verified function

    • Update GPR associations in the model

    • Include literature references

  • Reaction association:

    • Add new reactions catalyzed by Cgl1270/cg1434

    • Modify existing reactions based on new evidence

    • Ensure mass balance and thermodynamic feasibility

  • Model validation:

    • Simulate growth on different media

    • Compare predictions with experimental data

    • Perform sensitivity analysis

Tools for integration:

  • COBRA Toolbox (MATLAB/Python)

  • CarveMe for model refinement

  • ModelSEED for automated reconstruction

  • Memote for model testing and validation

How should researchers resolve conflicting experimental data regarding Cgl1270/cg1434?

When faced with contradictory results for Cgl1270/cg1434 function, apply this systematic approach:

Conflict resolution protocol:

  • Methodological analysis:

    • Compare experimental conditions (growth media, strain backgrounds)

    • Evaluate methodological rigor and reproducibility

    • Assess statistical power and significance

  • Hierarchical evidence assessment:

    • Direct biochemical evidence > genetic evidence > computational predictions

    • In vivo studies > in vitro studies > in silico predictions

    • Multiple consistent studies > single studies

  • Biological context consideration:

    • Regulatory effects under different conditions

    • Strain-specific genetic background effects

    • Potential moonlighting functions

  • Reconciliation approaches:

    • Design critical experiments to specifically address contradictions

    • Perform meta-analysis of available data

    • Develop models that incorporate condition-specific behavior

For example, if gene knockout shows no phenotype but metabolomic data suggests involvement in a pathway, consider genetic redundancy, condition-specific activation, or indirect effects .

How might Cgl1270/cg1434 contribute to metabolic engineering applications in C. glutamicum?

Understanding Cgl1270/cg1434 could unlock new metabolic engineering opportunities:

Potential applications:

  • Amino acid production enhancement:

    • If involved in membrane transport, could improve nutrient uptake or product export

    • May influence glutamate production pathways

    • Could affect stress response during fermentation

  • Bioprocess optimization targets:

    • Potential role in pH homeostasis or osmotic regulation

    • May affect growth under industrial fermentation conditions

    • Could influence cell envelope properties relevant to downstream processing

  • Novel product biosynthesis:

    • Possible involvement in secondary metabolite pathways

    • May enable new product synthesis through pathway engineering

    • Could serve as a scaffold for synthetic biology applications

Engineering approaches:

  • Promoter engineering for controlled expression

  • Protein engineering for enhanced activity

  • Integration into synthetic pathways

  • Regulatory circuit design incorporating Cgl1270/cg1434

What systems biology approaches will accelerate characterization of Cgl1270/cg1434?

Advanced systems biology approaches offer powerful tools for characterizing Cgl1270/cg1434:

Multi-omics integration:

  • Transcriptomic profiling:

    • RNA-seq under diverse conditions

    • Identification of co-expressed genes

    • Regulatory network inference

  • Proteomic analysis:

    • Abundance profiling under various conditions

    • Post-translational modification mapping

    • Protein-protein interaction networks

  • Metabolomic studies:

    • Targeted and untargeted metabolite profiling

    • Stable isotope labeling experiments

    • Flux analysis for pathway elucidation

  • Integration frameworks:

    • Multi-omics data integration platforms

    • Machine learning for pattern recognition

    • Causal network modeling

Advanced computational approaches:

  • Genome-scale models with integrated -omics data

  • Protein structure-based metabolic modeling

  • Dynamic flux balance analysis

  • Whole-cell modeling incorporating Cgl1270/cg1434

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.