Recombinant Corynebacterium glutamicum Uncharacterized protein Cgl2769/cg3067 (Cgl2769, cg3067)

Shipped with Ice Packs
In Stock

Description

Biochemical Characteristics

Cgl2769/cg3067 is a hypothetical protein with no established functional annotation. Key features include:

PropertyDetails
Gene NamesCgl2769, cg3067
StrainCorynebacterium glutamicum ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025
UniProt IDQ99340
Amino Acid SequenceMAKKKLGTVARLSELDKSLRNRLLRVRSRLLFIVHSAIGAGVAYWIAVEVIKHGQPFFAP MSAVIILGLSGGDRIKRATELTLGCALGVGLGDLLIMQIGTGYWQIFVVVGLALLVASFV SPAPLVSNQMAIGGILIATMFPPGDGGSIDRMIDAFIGGGVGILVIALLPSSPLDAGRHQ VANVLGIAASVLEDVAASLKAKDAAKLNNALEALRRSQASVNKLETAASSGKEATTVSPF LWGDRARVRSLYRILAPVDNVIRNARVLARRAVVLTEDNDTVSDEQIHVIEEIADIALRL SDLYEHHKEISEALEIPELVNRLRQLGSEVGEDIAEDRVLSAQVILAQSRSIIVDLLQIC GMSRESAVAVLVPTSESPAYPPELWDDED
Length389 residues
Signal PeptideNot explicitly identified in available data
Protein ClassHypothetical membrane protein

The sequence lacks clear homology to characterized proteins, suggesting a novel or lineage-specific function .

Genomic Context and Mutational Insights

Cgl2769/cg3067 is encoded in the C. glutamicum genome, with genomics studies highlighting its genomic neighborhood. Key findings include:

  • Genomic Loci: Part of the C. glutamicum ATCC 13032 genome, adjacent to genes encoding hypothetical proteins and transmembrane components .

  • Mutational Analysis: Genome sequencing of industrial C. glutamicum strains revealed single nucleotide polymorphisms (SNPs) and deletion/insertion polymorphisms (DIPs) in related genomic regions, though direct mutations in Cgl2769/cg3067 were not explicitly documented .

Recombinant Expression and ELISA Detection

The recombinant protein is commercially available as an ELISA kit for research purposes . Key specifications include:

ParameterDetails
Product TypeRecombinant protein
Quantity50 µg (custom quantities available)
Storage BufferTris-based buffer, 50% glycerol
Storage Conditions-20°C (avoid repeated freeze-thaw cycles)
ApplicationDetection of Cgl2769/cg3067 in C. glutamicum cultures or engineered systems

This kit enables quantitative analysis of protein expression levels in biotechnological studies .

Role in Corynebacterium glutamicum Secretome Studies

While not explicitly identified in large-scale secretome analyses , hypothetical proteins like Cgl2769/cg3067 are often abundant in C. glutamicum supernatants. For example:

  • Secretome Composition: Studies report 427 secreted proteins in C. glutamicum, with hypothetical proteins constituting a significant fraction .

  • Signal Peptide Utilization: The Sec and Tat pathways dominate protein secretion in C. glutamicum, though Cgl2769/cg3067 lacks a confirmed signal peptide .

Table 1: Amino Acid Sequence Segments

SegmentSequence
N-TerminalMAKKKLGTVARLSELDKSLRNRLLRVRSRLLFIVHSAIGAGVAYWIAVEVIKHGQPFFAP MSAVIILGLSGGDRIKRATELTLGCALGVGLGDLLIMQIGTGYWQIFVVVGLALLVASFV
C-TerminalSPAPLVSNQMAIGGILIATMFPPGDGGSIDRMIDAFIGGGVGILVIALLPSSPLDAGRHQ VANVLGIAASVLEDVAASLKAKDAAKLNNALEALRRSQASVNKLETAASSGKEATTVSPF LWGDRARVRSLYRILAPVDNVIRNARVLARRAVVLTEDNDTVSDEQIHVIEEIADIALRL SDLYEHHKEISEALEIPELVNRLRQLGSEVGEDIAEDRVLSAQVILAQSRSIIVDLLQIC GMSRESAVAVLVPTSESPAYPPELWDDED

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we currently have in stock. However, if you have any specific format requirements, please include them in your order notes. We will fulfill your requests to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. This can serve as a reference for your own preparations.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We will prioritize developing the specified tag type if you have a particular requirement. Please inform us of your preference.
Synonyms
Cgl2769; cg3067; Uncharacterized protein Cgl2769/cg3067
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-389
Protein Length
full length protein
Species
Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025)
Target Names
Cgl2769
Target Protein Sequence
MAKKKLGTVARLSELDKSLRNRLLRVRSRLLFIVHSAIGAGVAYWIAVEVIKHGQPFFAP MSAVIILGLSGGDRIKRATELTLGCALGVGLGDLLIMQIGTGYWQIFVVVGLALLVASFV SPAPLVSNQMAIGGILIATMFPPGDGGSIDRMIDAFIGGGVGILVIALLPSSPLDAGRHQ VANVLGIAASVLEDVAASLKAKDAAKLNNALEALRRSQASVNKLETAASSGKEATTVSPF LWGDRARVRSLYRILAPVDNVIRNARVLARRAVVLTEDNDTVSDEQIHVIEEIADIALRL SDLYEHHKEISEALEIPELVNRLRQLGSEVGEDIAEDRVLSAQVILAQSRSIIVDLLQIC GMSRESAVAVLVPTSESPAYPPELWDDED
Uniprot No.

Target Background

Database Links

KEGG: cgb:cg3067

STRING: 196627.cg3067

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Corynebacterium glutamicum and why is it advantageous for recombinant protein expression?

Corynebacterium glutamicum ATCC 13032 is a Generally Regarded As Safe (GRAS) soil actinobacterium widely utilized in industrial applications . It presents several significant advantages over Escherichia coli as a prokaryotic host for recombinant protein expression . These advantages include inherently low levels of cytoplasmic and extracellular proteases, which minimize target protein degradation during expression and purification processes . C. glutamicum also possesses well-characterized secretion pathways, specifically the general secretory (SEC) and twin-arginine translocation (TAT) pathways, enabling efficient protein export . Additionally, it is an endotoxin-free strain, making it particularly suitable for producing proteins for therapeutic applications without concerns of endotoxin contamination .

During the past decades, numerous experimental techniques and vector components for genetic manipulation of C. glutamicum have been developed and validated, including strong promoters for tightly regulating target gene expression, various types of plasmid vectors, protein secretion systems, and methods for genetically modifying the host strain genome to improve protein production potential .

What transformation methods are available for C. glutamicum and how effective are they?

For introducing recombinant DNA into C. glutamicum, a protoplast transformation system has been developed based on polyethylene glycol (PEG)-mediated DNA uptake . The method involves:

  • Growing C. glutamicum cells in the presence of glycine before lysozyme treatment, which results in greater than 99% protoplast formation (defined as the percentage of cells unable to form colonies on LB agar after treatment) .

  • Mixing the protoplasts with plasmid DNA (such as shuttle vectors) and treating them with PEG following procedures similar to those established for other bacterial species .

  • Plating the transformed protoplasts on regeneration medium and later selecting transformants on appropriate antibiotic-containing media .

Initial transformation efficiencies were lower than 1 transformant per μg of plasmid DNA, but optimization of the protocol has significantly improved these rates . When optimizing transformations, researchers should consider variables such as growth conditions, protoplast preparation methods, PEG concentration, and plasmid vector design.

What vector systems are recommended for expressing Cgl2769/cg3067 in C. glutamicum?

For expressing uncharacterized proteins like Cgl2769/cg3067, several vector systems have been developed specifically for C. glutamicum:

  • Shuttle vectors: These plasmids can replicate in both C. glutamicum and other bacteria like Bacillus subtilis or E. coli, facilitating easier cloning and vector manipulation. For example, the 9.4-kb C. glutamicum-B. subtilis shuttle vector system has been successfully used for cloning and expression of foreign genes in C. glutamicum .

  • Expression vectors with strong promoters: Various plasmid vectors incorporating promoters that allow tight regulation of target gene expression have been developed for C. glutamicum . These include inducible promoter systems that can be fine-tuned to optimize expression levels.

  • Secretion vectors: For proteins that benefit from extracellular expression, vectors containing appropriate signal sequences can direct the protein through either the SEC or TAT secretion pathways in C. glutamicum .

When selecting a vector system, consider compatibility with the host strain, copy number, stability, selection markers, and expression control elements appropriate for your specific research goals with Cgl2769/cg3067.

How can protein-O-mannosylation affect expression and function of Cgl2769/cg3067?

C. glutamicum is capable of protein-O-mannosylation (POM), a form of O-glycosylation that might significantly impact your recombinant Cgl2769/cg3067 protein . Consider the following methodological approaches:

  • Determine if Cgl2769/cg3067 is a substrate for POM: Analyze the protein sequence for Ser/Thr-rich regions that could be targets for mannosylation. Express the protein in both wild-type C. glutamicum and a POM-deficient strain (with GT-39 knockout) to compare post-translational modifications .

  • Assess the impact of mannosylation on protein function: If Cgl2769/cg3067 is mannosylated, conduct comparative functional assays between mannosylated and non-mannosylated forms to determine if this modification affects activity, stability, or localization.

  • Characterize the pattern of mannosylation: Use mass spectrometry and glycan analysis techniques to identify specific mannosylation sites and patterns on the expressed Cgl2769/cg3067 protein.

Research indicates that POM in C. glutamicum occurs not only in a SEC-dependent manner but also with TAT and non-SEC secreted substrates in a specific and tightly regulated manner . This suggests that the secretion pathway chosen for your recombinant protein may affect its mannosylation pattern.

What approaches are recommended for determining the subcellular localization of Cgl2769/cg3067?

To determine the subcellular localization of Cgl2769/cg3067, implement the following methodological approach:

  • Bioinformatic prediction: Use tools like TMHMM to identify potential transmembrane helices and SignalP to predict secretion capability and potential signal peptide cleavage sites . These predictions can provide initial insights into whether the protein is likely cytoplasmic, membrane-associated, or secreted.

  • Fluorescent fusion proteins: Generate constructs expressing Cgl2769/cg3067 fused to fluorescent proteins (e.g., GFP) at either the N- or C-terminus, considering the potential impact on protein folding and function. Express these in C. glutamicum and visualize using fluorescence microscopy.

  • Subcellular fractionation: Separate C. glutamicum cells expressing Cgl2769/cg3067 into cytoplasmic, membrane, cell wall, and extracellular fractions. Analyze each fraction by Western blotting using antibodies against your protein of interest or a fusion tag.

  • Immunogold electron microscopy: For high-resolution localization, use antibodies against Cgl2769/cg3067 or a fusion tag, followed by gold-conjugated secondary antibodies and electron microscopy imaging.

  • Secretion pathway analysis: Examine expression and localization in strains with defects in specific secretion pathways (SEC or TAT) to determine which pathway, if any, is involved in the protein's transport.

What experimental approaches should be used to characterize the function of Cgl2769/cg3067?

Characterizing an uncharacterized protein like Cgl2769/cg3067 requires a multi-faceted approach:

  • Comparative genomics and in silico analysis:

    • Identify homologs in related species and examine synteny (gene order conservation) to infer potential function

    • Analyze protein domains, motifs, and predicted secondary structure

    • Use structure prediction tools such as AlphaFold to generate a structural model

  • Gene deletion and complementation studies:

    • Generate a Cgl2769/cg3067 knockout strain in C. glutamicum

    • Perform phenotypic characterization (growth curves, metabolite analysis, stress responses)

    • Complement with the wild-type gene to confirm phenotype association

    • Express homologs from related species to test functional conservation

  • Protein interaction studies:

    • Perform pull-down assays using tagged Cgl2769/cg3067

    • Conduct bacterial two-hybrid screens

    • Implement crosslinking mass spectrometry to identify interacting partners

    • Use co-immunoprecipitation followed by mass spectrometry to identify protein complexes

  • Biochemical activity assays:

    • Design assays based on predicted function from bioinformatic analyses

    • Test for enzymatic activities such as hydrolase, transferase, or regulatory functions

    • Examine substrate specificity if enzymatic activity is identified

  • Localization and expression profiling:

    • Determine subcellular localization (see question 2.2)

    • Analyze expression patterns under different growth conditions using RT-qPCR

    • Use reporter gene fusions to monitor promoter activity

What expression strategies maximize yield and solubility of Cgl2769/cg3067?

To optimize expression of Cgl2769/cg3067 in C. glutamicum, implement the following methodological approaches:

  • Promoter selection and optimization:

    • Use strong, tightly regulated promoters available for C. glutamicum

    • Test both constitutive and inducible promoter systems

    • Consider the tac promoter for high-level expression or native C. glutamicum promoters for more physiological expression levels

  • Codon optimization:

    • Analyze the codon usage of Cgl2769/cg3067 and optimize for C. glutamicum codon preference

    • Avoid rare codons, especially in the N-terminal region

    • Eliminate potential secondary structures in the mRNA that could impede translation

  • Growth and induction conditions:

    • Test different growth temperatures (25-37°C)

    • Optimize media composition (carbon sources, nitrogen sources, trace elements)

    • For inducible systems, test various inducer concentrations and induction timing

    • Consider using fed-batch cultivation to achieve higher cell densities

  • Fusion tag strategies:

    • Test N-terminal and C-terminal fusion tags (His6, GST, MBP, SUMO)

    • Include protease cleavage sites for tag removal

    • Consider dual-tagging approaches for enhanced detection and purification

  • Solubility enhancement:

    • Co-express molecular chaperones if misfolding is suspected

    • Use low growth temperatures to slow expression and improve folding

    • Test expression as a secreted protein using appropriate signal sequences

What purification strategies are most effective for Cgl2769/cg3067 expressed in C. glutamicum?

For purifying recombinant Cgl2769/cg3067 from C. glutamicum, consider this methodological framework:

  • Cell disruption optimization:

    • Test mechanical methods (sonication, homogenization) and chemical lysis

    • Optimize buffer conditions (pH, salt concentration, reducing agents)

    • Include appropriate protease inhibitors to prevent degradation

    • For membrane-associated proteins, evaluate different detergents for solubilization

  • Initial capture step:

    • For tagged proteins, use affinity chromatography (IMAC for His-tagged proteins, glutathione resin for GST fusions)

    • For secreted proteins, concentrate from culture supernatant using ammonium sulfate precipitation or ultrafiltration

    • Consider ion exchange chromatography based on predicted pI of Cgl2769/cg3067

  • Intermediate purification:

    • Size exclusion chromatography to separate monomeric protein from aggregates

    • Ion exchange chromatography orthogonal to the capture step

    • Hydrophobic interaction chromatography as an alternative approach

  • Polishing and quality control:

    • Final size exclusion chromatography in a buffer suitable for downstream applications

    • Analyze protein purity by SDS-PAGE and mass spectrometry

    • Verify protein identity by Western blotting or N-terminal sequencing

    • Assess protein folding using circular dichroism or thermal shift assays

  • Special considerations for C. glutamicum:

    • Take advantage of the low endogenous protease activity of C. glutamicum

    • If Cgl2769/cg3067 undergoes O-mannosylation, consider its impact on purification behavior and include appropriate analytical steps to characterize glycoforms

How should experiments be designed to study protein-protein interactions involving Cgl2769/cg3067?

To investigate protein-protein interactions involving Cgl2769/cg3067, implement these methodological approaches:

  • Co-immunoprecipitation (Co-IP):

    • Express tagged Cgl2769/cg3067 in C. glutamicum

    • Prepare cell lysates under non-denaturing conditions

    • Capture protein complexes using antibodies against the tag

    • Identify interacting partners by mass spectrometry

    • Validate key interactions by reciprocal Co-IP

  • Bacterial two-hybrid system:

    • Clone Cgl2769/cg3067 into appropriate bacterial two-hybrid vectors

    • Screen against a C. glutamicum genomic library

    • Confirm positive interactions by targeted testing

    • Quantify interaction strength using β-galactosidase assays

  • Pull-down assays:

    • Express and purify Cgl2769/cg3067 with an affinity tag

    • Incubate with C. glutamicum cell lysate or specific candidate proteins

    • Wash extensively to remove non-specific binders

    • Identify specific interactors by mass spectrometry or Western blotting

  • In vivo crosslinking:

    • Treat C. glutamicum expressing Cgl2769/cg3067 with crosslinking agents

    • Purify crosslinked complexes under denaturing conditions

    • Identify crosslinked peptides by mass spectrometry

    • Map interaction interfaces by analyzing crosslink positions

  • Surface plasmon resonance (SPR) or microscale thermophoresis (MST):

    • Use purified Cgl2769/cg3067 and potential interaction partners

    • Determine binding affinities and kinetics

    • Test the effects of mutations on interaction strength

    • Evaluate the impact of experimental conditions (pH, salt, temperature)

How can expression problems of Cgl2769/cg3067 in C. glutamicum be systematically troubleshooted?

When facing expression challenges with Cgl2769/cg3067 in C. glutamicum, implement this systematic troubleshooting approach:

  • Verify construct design and sequence:

    • Confirm sequence integrity by DNA sequencing

    • Check for inadvertent mutations or frame shifts

    • Ensure promoter, ribosome binding site, and coding sequence are correctly positioned

    • Verify compatibility of any fusion tags with the protein structure

  • Optimize expression conditions:

    • Test different media formulations and growth temperatures

    • For inducible systems, vary inducer concentration and induction timing

    • Monitor growth curves to identify potential toxicity

    • Try different C. glutamicum host strains

  • Address protein solubility issues:

    • Test expression at lower temperatures (20-25°C)

    • Co-express molecular chaperones or foldases

    • Try fusion partners known to enhance solubility (MBP, SUMO, Trx)

    • Express protein fragments if the full-length protein proves problematic

  • Evaluate protein stability:

    • Include protease inhibitors during extraction and purification

    • Test different buffer conditions for improved stability

    • Check for degradation products by Western blotting

    • Consider directed evolution approaches to enhance stability

  • Examine codon usage and mRNA structure:

    • Analyze codon adaptation index for C. glutamicum

    • Look for rare codons that might cause translational pausing

    • Check for strong secondary structures in the mRNA, particularly near the start codon

    • Redesign the coding sequence while maintaining the amino acid sequence

What analytical methods should be used to confirm the identity and integrity of purified Cgl2769/cg3067?

To verify the identity and integrity of purified Cgl2769/cg3067, implement these analytical methods:

  • SDS-PAGE and Western blotting:

    • Assess purity, molecular weight, and potential degradation

    • Use antibodies against Cgl2769/cg3067 or fusion tags for specific detection

    • Perform native PAGE to evaluate oligomeric state

  • Mass spectrometry:

    • Intact protein mass analysis to confirm molecular weight

    • Peptide mass fingerprinting after proteolytic digestion

    • Bottom-up proteomics to verify sequence coverage

    • Top-down proteomics for comprehensive characterization

    • Identify post-translational modifications, including O-mannosylation

  • N-terminal sequencing:

    • Verify the correct start of the protein

    • Identify potential signal peptide cleavage

    • Detect unexpected N-terminal processing

  • Circular dichroism (CD) spectroscopy:

    • Assess secondary structure content

    • Evaluate thermal stability through melting curves

    • Compare with predictions from sequence analysis

  • Dynamic light scattering (DLS):

    • Measure size distribution and hydrodynamic radius

    • Detect aggregation or multimerization

    • Assess sample homogeneity

  • Analytical size exclusion chromatography:

    • Determine oligomeric state

    • Evaluate sample homogeneity

    • Compare with theoretical molecular weight

The analytical strategy should be tailored to the specific characteristics of Cgl2769/cg3067 and the requirements of downstream applications.

How can bioinformatic tools be effectively used to predict the function of Cgl2769/cg3067?

To predict the function of uncharacterized protein Cgl2769/cg3067, implement this comprehensive bioinformatic approach:

  • Sequence homology analysis:

    • Perform BLAST searches against protein databases

    • Use position-specific iterative BLAST (PSI-BLAST) for remote homologs

    • Apply Hidden Markov Model (HMM) profile searches using HMMER

    • Search against specialized databases like CAZy for carbohydrate-active enzymes

  • Protein domain and motif identification:

    • Search against domain databases (Pfam, SMART, InterPro)

    • Identify conserved motifs using MEME and PROSITE

    • Analyze the architecture of multi-domain proteins

    • Map conserved catalytic or binding residues

  • Structural prediction and analysis:

    • Generate 3D structural models using AlphaFold or I-TASSER

    • Compare predicted structures to known protein structures using DALI

    • Identify potential binding pockets or catalytic sites

    • Perform molecular docking with potential substrates

  • Genomic context analysis:

    • Examine gene neighborhood and operonic structure

    • Look for conserved gene clusters across species

    • Apply guilt-by-association approaches for functional inference

    • Use STRING database to identify functional associations

  • Specialized prediction tools:

    • Use TMHMM for transmembrane helix prediction

    • Apply SignalP for secretion capability prediction

    • Employ specialized tools for subcellular localization

    • Identify potential post-translational modification sites

Bioinformatic MethodToolsApplication to Cgl2769/cg3067
Sequence similarityBLAST, PSI-BLAST, FASTAIdentify homologs and potential function
Domain analysisPfam, SMART, InterProCharacterize functional domains
Structural predictionAlphaFold, I-TASSER, RobettaPredict 3D structure
Genomic contextSTRING, MicrobesOnlineIdentify functional associations
Localization predictionTMHMM, SignalP, PSORTPredict cellular location
Pathway analysisKEGG, BioCycPlace protein in metabolic context

The results from these analyses should be integrated to develop testable hypotheses about the function of Cgl2769/cg3067, which can then be verified experimentally.

How can genetic modification improve C. glutamicum as an expression host for Cgl2769/cg3067?

To enhance C. glutamicum for optimal expression of Cgl2769/cg3067, implement these genetic modification strategies:

  • Protease deficient strains:

    • Identify and delete genes encoding problematic proteases

    • Target intracellular proteases if Cgl2769/cg3067 is expressed cytoplasmically

    • Remove extracellular or periplasmic proteases for secreted constructs

    • C. glutamicum already has relatively low protease activity, but further optimization may be beneficial

  • Secretion pathway engineering:

    • Overexpress components of SEC or TAT pathways depending on your secretion strategy

    • Delete competing secreted proteins to increase resources for Cgl2769/cg3067

    • Modify signal peptides for improved translocation efficiency

    • Consider the impact of protein-O-mannosylation on secretion efficiency

  • Chaperone co-expression:

    • Overexpress molecular chaperones to improve folding

    • Test combinations of different chaperone systems

    • Consider cold-shock inducible chaperones for low-temperature expression

  • Metabolic engineering:

    • Modify central carbon metabolism to increase precursor availability

    • Enhance ATP production for improved protein synthesis

    • Redirect carbon flux away from competing pathways

    • Optimize amino acid biosynthesis pathways for improved protein production

  • Genome reduction:

    • Remove non-essential genes to create streamlined host strains

    • Delete mobile genetic elements and prophages

    • Remove competing resource-intensive processes

These genetic modifications should be implemented systematically, evaluating their impact on Cgl2769/cg3067 expression at each step.

What can be learned from comparing the expression and characterization of Cgl2769/cg3067 across different bacterial hosts?

A comparative approach to expressing Cgl2769/cg3067 in multiple bacterial hosts can provide valuable insights:

  • Host-specific post-translational modifications:

    • Compare O-mannosylation patterns between C. glutamicum and other actinobacteria

    • Assess the impact of different glycosylation patterns on protein function

    • Evaluate differences in proteolytic processing across hosts

  • Folding efficiency and solubility:

    • Compare expression levels and soluble fraction across hosts

    • Identify host-specific folding bottlenecks

    • Determine optimal host for high-yield production

  • Functional variations:

    • Test if protein function is conserved across expression hosts

    • Identify host factors that might influence activity

    • Assess if heterologously expressed protein recapitulates native function

  • Structural differences:

    • Compare structural characteristics using CD spectroscopy or thermal stability assays

    • Identify host-specific structural variations

    • Determine if observed differences correlate with functional changes

  • Interactome comparisons:

    • Identify host-specific protein-protein interactions

    • Distinguish between conserved and variable interacting partners

    • Determine if differences in interactome affect function

A systematic comparison across hosts such as C. glutamicum, E. coli, B. subtilis, and other relevant bacteria can provide comprehensive insights into the intrinsic properties of Cgl2769/cg3067 versus host-dependent characteristics.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.