Cgl2769/cg3067 is a hypothetical protein with no established functional annotation. Key features include:
| Property | Details |
|---|---|
| Gene Names | Cgl2769, cg3067 |
| Strain | Corynebacterium glutamicum ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025 |
| UniProt ID | Q99340 |
| Amino Acid Sequence | MAKKKLGTVARLSELDKSLRNRLLRVRSRLLFIVHSAIGAGVAYWIAVEVIKHGQPFFAP MSAVIILGLSGGDRIKRATELTLGCALGVGLGDLLIMQIGTGYWQIFVVVGLALLVASFV SPAPLVSNQMAIGGILIATMFPPGDGGSIDRMIDAFIGGGVGILVIALLPSSPLDAGRHQ VANVLGIAASVLEDVAASLKAKDAAKLNNALEALRRSQASVNKLETAASSGKEATTVSPF LWGDRARVRSLYRILAPVDNVIRNARVLARRAVVLTEDNDTVSDEQIHVIEEIADIALRL SDLYEHHKEISEALEIPELVNRLRQLGSEVGEDIAEDRVLSAQVILAQSRSIIVDLLQIC GMSRESAVAVLVPTSESPAYPPELWDDED |
| Length | 389 residues |
| Signal Peptide | Not explicitly identified in available data |
| Protein Class | Hypothetical membrane protein |
The sequence lacks clear homology to characterized proteins, suggesting a novel or lineage-specific function .
Cgl2769/cg3067 is encoded in the C. glutamicum genome, with genomics studies highlighting its genomic neighborhood. Key findings include:
Genomic Loci: Part of the C. glutamicum ATCC 13032 genome, adjacent to genes encoding hypothetical proteins and transmembrane components .
Mutational Analysis: Genome sequencing of industrial C. glutamicum strains revealed single nucleotide polymorphisms (SNPs) and deletion/insertion polymorphisms (DIPs) in related genomic regions, though direct mutations in Cgl2769/cg3067 were not explicitly documented .
The recombinant protein is commercially available as an ELISA kit for research purposes . Key specifications include:
| Parameter | Details |
|---|---|
| Product Type | Recombinant protein |
| Quantity | 50 µg (custom quantities available) |
| Storage Buffer | Tris-based buffer, 50% glycerol |
| Storage Conditions | -20°C (avoid repeated freeze-thaw cycles) |
| Application | Detection of Cgl2769/cg3067 in C. glutamicum cultures or engineered systems |
This kit enables quantitative analysis of protein expression levels in biotechnological studies .
While not explicitly identified in large-scale secretome analyses , hypothetical proteins like Cgl2769/cg3067 are often abundant in C. glutamicum supernatants. For example:
Secretome Composition: Studies report 427 secreted proteins in C. glutamicum, with hypothetical proteins constituting a significant fraction .
Signal Peptide Utilization: The Sec and Tat pathways dominate protein secretion in C. glutamicum, though Cgl2769/cg3067 lacks a confirmed signal peptide .
| Segment | Sequence |
|---|---|
| N-Terminal | MAKKKLGTVARLSELDKSLRNRLLRVRSRLLFIVHSAIGAGVAYWIAVEVIKHGQPFFAP MSAVIILGLSGGDRIKRATELTLGCALGVGLGDLLIMQIGTGYWQIFVVVGLALLVASFV |
| C-Terminal | SPAPLVSNQMAIGGILIATMFPPGDGGSIDRMIDAFIGGGVGILVIALLPSSPLDAGRHQ VANVLGIAASVLEDVAASLKAKDAAKLNNALEALRRSQASVNKLETAASSGKEATTVSPF LWGDRARVRSLYRILAPVDNVIRNARVLARRAVVLTEDNDTVSDEQIHVIEEIADIALRL SDLYEHHKEISEALEIPELVNRLRQLGSEVGEDIAEDRVLSAQVILAQSRSIIVDLLQIC GMSRESAVAVLVPTSESPAYPPELWDDED |
KEGG: cgb:cg3067
STRING: 196627.cg3067
Corynebacterium glutamicum ATCC 13032 is a Generally Regarded As Safe (GRAS) soil actinobacterium widely utilized in industrial applications . It presents several significant advantages over Escherichia coli as a prokaryotic host for recombinant protein expression . These advantages include inherently low levels of cytoplasmic and extracellular proteases, which minimize target protein degradation during expression and purification processes . C. glutamicum also possesses well-characterized secretion pathways, specifically the general secretory (SEC) and twin-arginine translocation (TAT) pathways, enabling efficient protein export . Additionally, it is an endotoxin-free strain, making it particularly suitable for producing proteins for therapeutic applications without concerns of endotoxin contamination .
During the past decades, numerous experimental techniques and vector components for genetic manipulation of C. glutamicum have been developed and validated, including strong promoters for tightly regulating target gene expression, various types of plasmid vectors, protein secretion systems, and methods for genetically modifying the host strain genome to improve protein production potential .
For introducing recombinant DNA into C. glutamicum, a protoplast transformation system has been developed based on polyethylene glycol (PEG)-mediated DNA uptake . The method involves:
Growing C. glutamicum cells in the presence of glycine before lysozyme treatment, which results in greater than 99% protoplast formation (defined as the percentage of cells unable to form colonies on LB agar after treatment) .
Mixing the protoplasts with plasmid DNA (such as shuttle vectors) and treating them with PEG following procedures similar to those established for other bacterial species .
Plating the transformed protoplasts on regeneration medium and later selecting transformants on appropriate antibiotic-containing media .
Initial transformation efficiencies were lower than 1 transformant per μg of plasmid DNA, but optimization of the protocol has significantly improved these rates . When optimizing transformations, researchers should consider variables such as growth conditions, protoplast preparation methods, PEG concentration, and plasmid vector design.
For expressing uncharacterized proteins like Cgl2769/cg3067, several vector systems have been developed specifically for C. glutamicum:
Shuttle vectors: These plasmids can replicate in both C. glutamicum and other bacteria like Bacillus subtilis or E. coli, facilitating easier cloning and vector manipulation. For example, the 9.4-kb C. glutamicum-B. subtilis shuttle vector system has been successfully used for cloning and expression of foreign genes in C. glutamicum .
Expression vectors with strong promoters: Various plasmid vectors incorporating promoters that allow tight regulation of target gene expression have been developed for C. glutamicum . These include inducible promoter systems that can be fine-tuned to optimize expression levels.
Secretion vectors: For proteins that benefit from extracellular expression, vectors containing appropriate signal sequences can direct the protein through either the SEC or TAT secretion pathways in C. glutamicum .
When selecting a vector system, consider compatibility with the host strain, copy number, stability, selection markers, and expression control elements appropriate for your specific research goals with Cgl2769/cg3067.
C. glutamicum is capable of protein-O-mannosylation (POM), a form of O-glycosylation that might significantly impact your recombinant Cgl2769/cg3067 protein . Consider the following methodological approaches:
Determine if Cgl2769/cg3067 is a substrate for POM: Analyze the protein sequence for Ser/Thr-rich regions that could be targets for mannosylation. Express the protein in both wild-type C. glutamicum and a POM-deficient strain (with GT-39 knockout) to compare post-translational modifications .
Assess the impact of mannosylation on protein function: If Cgl2769/cg3067 is mannosylated, conduct comparative functional assays between mannosylated and non-mannosylated forms to determine if this modification affects activity, stability, or localization.
Characterize the pattern of mannosylation: Use mass spectrometry and glycan analysis techniques to identify specific mannosylation sites and patterns on the expressed Cgl2769/cg3067 protein.
Research indicates that POM in C. glutamicum occurs not only in a SEC-dependent manner but also with TAT and non-SEC secreted substrates in a specific and tightly regulated manner . This suggests that the secretion pathway chosen for your recombinant protein may affect its mannosylation pattern.
To determine the subcellular localization of Cgl2769/cg3067, implement the following methodological approach:
Bioinformatic prediction: Use tools like TMHMM to identify potential transmembrane helices and SignalP to predict secretion capability and potential signal peptide cleavage sites . These predictions can provide initial insights into whether the protein is likely cytoplasmic, membrane-associated, or secreted.
Fluorescent fusion proteins: Generate constructs expressing Cgl2769/cg3067 fused to fluorescent proteins (e.g., GFP) at either the N- or C-terminus, considering the potential impact on protein folding and function. Express these in C. glutamicum and visualize using fluorescence microscopy.
Subcellular fractionation: Separate C. glutamicum cells expressing Cgl2769/cg3067 into cytoplasmic, membrane, cell wall, and extracellular fractions. Analyze each fraction by Western blotting using antibodies against your protein of interest or a fusion tag.
Immunogold electron microscopy: For high-resolution localization, use antibodies against Cgl2769/cg3067 or a fusion tag, followed by gold-conjugated secondary antibodies and electron microscopy imaging.
Secretion pathway analysis: Examine expression and localization in strains with defects in specific secretion pathways (SEC or TAT) to determine which pathway, if any, is involved in the protein's transport.
Characterizing an uncharacterized protein like Cgl2769/cg3067 requires a multi-faceted approach:
Comparative genomics and in silico analysis:
Identify homologs in related species and examine synteny (gene order conservation) to infer potential function
Analyze protein domains, motifs, and predicted secondary structure
Use structure prediction tools such as AlphaFold to generate a structural model
Gene deletion and complementation studies:
Generate a Cgl2769/cg3067 knockout strain in C. glutamicum
Perform phenotypic characterization (growth curves, metabolite analysis, stress responses)
Complement with the wild-type gene to confirm phenotype association
Express homologs from related species to test functional conservation
Protein interaction studies:
Perform pull-down assays using tagged Cgl2769/cg3067
Conduct bacterial two-hybrid screens
Implement crosslinking mass spectrometry to identify interacting partners
Use co-immunoprecipitation followed by mass spectrometry to identify protein complexes
Biochemical activity assays:
Design assays based on predicted function from bioinformatic analyses
Test for enzymatic activities such as hydrolase, transferase, or regulatory functions
Examine substrate specificity if enzymatic activity is identified
Localization and expression profiling:
Determine subcellular localization (see question 2.2)
Analyze expression patterns under different growth conditions using RT-qPCR
Use reporter gene fusions to monitor promoter activity
To optimize expression of Cgl2769/cg3067 in C. glutamicum, implement the following methodological approaches:
Promoter selection and optimization:
Codon optimization:
Analyze the codon usage of Cgl2769/cg3067 and optimize for C. glutamicum codon preference
Avoid rare codons, especially in the N-terminal region
Eliminate potential secondary structures in the mRNA that could impede translation
Growth and induction conditions:
Test different growth temperatures (25-37°C)
Optimize media composition (carbon sources, nitrogen sources, trace elements)
For inducible systems, test various inducer concentrations and induction timing
Consider using fed-batch cultivation to achieve higher cell densities
Fusion tag strategies:
Test N-terminal and C-terminal fusion tags (His6, GST, MBP, SUMO)
Include protease cleavage sites for tag removal
Consider dual-tagging approaches for enhanced detection and purification
Solubility enhancement:
Co-express molecular chaperones if misfolding is suspected
Use low growth temperatures to slow expression and improve folding
Test expression as a secreted protein using appropriate signal sequences
For purifying recombinant Cgl2769/cg3067 from C. glutamicum, consider this methodological framework:
Cell disruption optimization:
Test mechanical methods (sonication, homogenization) and chemical lysis
Optimize buffer conditions (pH, salt concentration, reducing agents)
Include appropriate protease inhibitors to prevent degradation
For membrane-associated proteins, evaluate different detergents for solubilization
Initial capture step:
For tagged proteins, use affinity chromatography (IMAC for His-tagged proteins, glutathione resin for GST fusions)
For secreted proteins, concentrate from culture supernatant using ammonium sulfate precipitation or ultrafiltration
Consider ion exchange chromatography based on predicted pI of Cgl2769/cg3067
Intermediate purification:
Size exclusion chromatography to separate monomeric protein from aggregates
Ion exchange chromatography orthogonal to the capture step
Hydrophobic interaction chromatography as an alternative approach
Polishing and quality control:
Final size exclusion chromatography in a buffer suitable for downstream applications
Analyze protein purity by SDS-PAGE and mass spectrometry
Verify protein identity by Western blotting or N-terminal sequencing
Assess protein folding using circular dichroism or thermal shift assays
Special considerations for C. glutamicum:
To investigate protein-protein interactions involving Cgl2769/cg3067, implement these methodological approaches:
Co-immunoprecipitation (Co-IP):
Express tagged Cgl2769/cg3067 in C. glutamicum
Prepare cell lysates under non-denaturing conditions
Capture protein complexes using antibodies against the tag
Identify interacting partners by mass spectrometry
Validate key interactions by reciprocal Co-IP
Bacterial two-hybrid system:
Clone Cgl2769/cg3067 into appropriate bacterial two-hybrid vectors
Screen against a C. glutamicum genomic library
Confirm positive interactions by targeted testing
Quantify interaction strength using β-galactosidase assays
Pull-down assays:
Express and purify Cgl2769/cg3067 with an affinity tag
Incubate with C. glutamicum cell lysate or specific candidate proteins
Wash extensively to remove non-specific binders
Identify specific interactors by mass spectrometry or Western blotting
In vivo crosslinking:
Treat C. glutamicum expressing Cgl2769/cg3067 with crosslinking agents
Purify crosslinked complexes under denaturing conditions
Identify crosslinked peptides by mass spectrometry
Map interaction interfaces by analyzing crosslink positions
Surface plasmon resonance (SPR) or microscale thermophoresis (MST):
Use purified Cgl2769/cg3067 and potential interaction partners
Determine binding affinities and kinetics
Test the effects of mutations on interaction strength
Evaluate the impact of experimental conditions (pH, salt, temperature)
When facing expression challenges with Cgl2769/cg3067 in C. glutamicum, implement this systematic troubleshooting approach:
Verify construct design and sequence:
Confirm sequence integrity by DNA sequencing
Check for inadvertent mutations or frame shifts
Ensure promoter, ribosome binding site, and coding sequence are correctly positioned
Verify compatibility of any fusion tags with the protein structure
Optimize expression conditions:
Test different media formulations and growth temperatures
For inducible systems, vary inducer concentration and induction timing
Monitor growth curves to identify potential toxicity
Try different C. glutamicum host strains
Address protein solubility issues:
Test expression at lower temperatures (20-25°C)
Co-express molecular chaperones or foldases
Try fusion partners known to enhance solubility (MBP, SUMO, Trx)
Express protein fragments if the full-length protein proves problematic
Evaluate protein stability:
Include protease inhibitors during extraction and purification
Test different buffer conditions for improved stability
Check for degradation products by Western blotting
Consider directed evolution approaches to enhance stability
Examine codon usage and mRNA structure:
Analyze codon adaptation index for C. glutamicum
Look for rare codons that might cause translational pausing
Check for strong secondary structures in the mRNA, particularly near the start codon
Redesign the coding sequence while maintaining the amino acid sequence
To verify the identity and integrity of purified Cgl2769/cg3067, implement these analytical methods:
SDS-PAGE and Western blotting:
Assess purity, molecular weight, and potential degradation
Use antibodies against Cgl2769/cg3067 or fusion tags for specific detection
Perform native PAGE to evaluate oligomeric state
Mass spectrometry:
N-terminal sequencing:
Verify the correct start of the protein
Identify potential signal peptide cleavage
Detect unexpected N-terminal processing
Circular dichroism (CD) spectroscopy:
Assess secondary structure content
Evaluate thermal stability through melting curves
Compare with predictions from sequence analysis
Dynamic light scattering (DLS):
Measure size distribution and hydrodynamic radius
Detect aggregation or multimerization
Assess sample homogeneity
Analytical size exclusion chromatography:
Determine oligomeric state
Evaluate sample homogeneity
Compare with theoretical molecular weight
The analytical strategy should be tailored to the specific characteristics of Cgl2769/cg3067 and the requirements of downstream applications.
To predict the function of uncharacterized protein Cgl2769/cg3067, implement this comprehensive bioinformatic approach:
Sequence homology analysis:
Perform BLAST searches against protein databases
Use position-specific iterative BLAST (PSI-BLAST) for remote homologs
Apply Hidden Markov Model (HMM) profile searches using HMMER
Search against specialized databases like CAZy for carbohydrate-active enzymes
Protein domain and motif identification:
Search against domain databases (Pfam, SMART, InterPro)
Identify conserved motifs using MEME and PROSITE
Analyze the architecture of multi-domain proteins
Map conserved catalytic or binding residues
Structural prediction and analysis:
Generate 3D structural models using AlphaFold or I-TASSER
Compare predicted structures to known protein structures using DALI
Identify potential binding pockets or catalytic sites
Perform molecular docking with potential substrates
Genomic context analysis:
Examine gene neighborhood and operonic structure
Look for conserved gene clusters across species
Apply guilt-by-association approaches for functional inference
Use STRING database to identify functional associations
Specialized prediction tools:
| Bioinformatic Method | Tools | Application to Cgl2769/cg3067 |
|---|---|---|
| Sequence similarity | BLAST, PSI-BLAST, FASTA | Identify homologs and potential function |
| Domain analysis | Pfam, SMART, InterPro | Characterize functional domains |
| Structural prediction | AlphaFold, I-TASSER, Robetta | Predict 3D structure |
| Genomic context | STRING, MicrobesOnline | Identify functional associations |
| Localization prediction | TMHMM, SignalP, PSORT | Predict cellular location |
| Pathway analysis | KEGG, BioCyc | Place protein in metabolic context |
The results from these analyses should be integrated to develop testable hypotheses about the function of Cgl2769/cg3067, which can then be verified experimentally.
To enhance C. glutamicum for optimal expression of Cgl2769/cg3067, implement these genetic modification strategies:
Protease deficient strains:
Identify and delete genes encoding problematic proteases
Target intracellular proteases if Cgl2769/cg3067 is expressed cytoplasmically
Remove extracellular or periplasmic proteases for secreted constructs
C. glutamicum already has relatively low protease activity, but further optimization may be beneficial
Secretion pathway engineering:
Chaperone co-expression:
Overexpress molecular chaperones to improve folding
Test combinations of different chaperone systems
Consider cold-shock inducible chaperones for low-temperature expression
Metabolic engineering:
Modify central carbon metabolism to increase precursor availability
Enhance ATP production for improved protein synthesis
Redirect carbon flux away from competing pathways
Optimize amino acid biosynthesis pathways for improved protein production
Genome reduction:
Remove non-essential genes to create streamlined host strains
Delete mobile genetic elements and prophages
Remove competing resource-intensive processes
These genetic modifications should be implemented systematically, evaluating their impact on Cgl2769/cg3067 expression at each step.
A comparative approach to expressing Cgl2769/cg3067 in multiple bacterial hosts can provide valuable insights:
Host-specific post-translational modifications:
Compare O-mannosylation patterns between C. glutamicum and other actinobacteria
Assess the impact of different glycosylation patterns on protein function
Evaluate differences in proteolytic processing across hosts
Folding efficiency and solubility:
Compare expression levels and soluble fraction across hosts
Identify host-specific folding bottlenecks
Determine optimal host for high-yield production
Functional variations:
Test if protein function is conserved across expression hosts
Identify host factors that might influence activity
Assess if heterologously expressed protein recapitulates native function
Structural differences:
Compare structural characteristics using CD spectroscopy or thermal stability assays
Identify host-specific structural variations
Determine if observed differences correlate with functional changes
Interactome comparisons:
Identify host-specific protein-protein interactions
Distinguish between conserved and variable interacting partners
Determine if differences in interactome affect function
A systematic comparison across hosts such as C. glutamicum, E. coli, B. subtilis, and other relevant bacteria can provide comprehensive insights into the intrinsic properties of Cgl2769/cg3067 versus host-dependent characteristics.