Recombinant Corynebacterium glutamicum Undecaprenyl-diphosphatase (uppP)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Corynebacterium glutamicum Undecaprenyl-diphosphatase (uppP)

Recombinant Corynebacterium glutamicum Undecaprenyl-diphosphatase (uppP) is an enzyme involved in the bacterial cell wall synthesis pathway. While specific information on this enzyme in Corynebacterium glutamicum is limited, understanding its role requires insight into the broader context of bacterial cell wall synthesis and the capabilities of Corynebacterium glutamicum as a recombinant host.

Corynebacterium glutamicum is a gram-positive bacterium widely used in industrial biotechnology for the production of amino acids, nucleotides, and other biochemicals . Its ability to express recombinant proteins makes it an attractive host for various biotechnological applications .

Role of Undecaprenyl-diphosphatase (uppP) in Bacterial Cell Wall Synthesis

Undecaprenyl-diphosphatase (uppP) is crucial in the bacterial cell wall synthesis pathway. It dephosphorylates undecaprenyl pyrophosphate to undecaprenyl monophosphate, which is necessary for the recycling of the lipid carrier involved in peptidoglycan synthesis .

Enzyme FunctionRole in Cell Wall Synthesis
Undecaprenyl-diphosphatase (uppP)Dephosphorylates undecaprenyl pyrophosphate to undecaprenyl monophosphate, facilitating peptidoglycan synthesis

Recombinant Expression in Corynebacterium glutamicum

Corynebacterium glutamicum is a versatile host for recombinant protein expression due to its low protease activity and absence of endotoxins, making it suitable for producing therapeutic proteins . The bacterium's metabolic pathways can be engineered to enhance the production of various biochemicals .

Advantages of Using Corynebacterium glutamicum

  • Low Protease Activity: Reduces protein degradation, enhancing yield and stability.

  • No Endotoxins: Simplifies purification processes for therapeutic proteins.

  • Metabolic Engineering: Allows for optimization of metabolic pathways to increase product yield.

Research Findings and Potential Applications

While specific research on recombinant Corynebacterium glutamicum Undecaprenyl-diphosphatase (uppP) is not detailed in the available literature, the enzyme's role in cell wall synthesis suggests potential applications in understanding bacterial cell wall dynamics and developing novel antimicrobial strategies.

Potential Applications

  • Antimicrobial Development: Targeting cell wall synthesis enzymes like uppP could lead to new antimicrobial compounds.

  • Biotechnological Applications: Engineering uppP in Corynebacterium glutamicum could enhance cell wall stability or modify bacterial surface properties for biotechnological uses.

References

- NCgl2620 encodes a class II polyphosphate kinase in Corynebacterium glutamicum.
- Recombinant Protein Expression System in Corynebacterium glutamicum.
- Overexpression of Genes Encoding Glycolytic Enzymes in Corynebacterium glutamicum.
- New Multiple-Deletion Method for the Corynebacterium glutamicum Genome.
- Corynebacterium glutamicum Metabolic Engineering with CRISPR.
- BioCyc: Corynebacterium glutamicum ATCC 13032 Undecaprenyl-diphosphatase.
- Metabolic engineering of Corynebacterium glutamicum aimed at amino acid production.
- Pyruvate:quinone oxidoreductase in Corynebacterium glutamicum.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. If you require a specific tag, please inform us for prioritized development.
Synonyms
uppP; cgR_1575; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-293
Protein Length
full length protein
Species
Corynebacterium glutamicum (strain R)
Target Names
uppP
Target Protein Sequence
MNEEITLLAAAADPAATENIGWVQTIVLSIVQGLTEFLPISSSGHLRIISELFWGADAGA SFTAVVQLGTEAAVLVFFAKEIWQIITGWFAGVFNKERRGFEYRMGWMIIVATIPVVILG VLGKDLIREALRNMWITASVLILFSLVFILAEKMGKKERDYDKLTMKDAIIMGLAQCLAL IPGVSRSGGTISAGLFLGLKREVATKFSFLLAIPAVLGSGLYSLPDAFAPSSGQAASGLQ LTVGTLFAFVVGYISIAWLMKFVANHSFSWFAAYRIPAGLLVMLLLALGMLNP
Uniprot No.

Target Background

Function
This recombinant Corynebacterium glutamicum Undecaprenyl-diphosphatase (UppP) catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP) and confers bacitracin resistance.
Database Links

KEGG: cgt:cgR_1575

Protein Families
UppP family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What makes Corynebacterium glutamicum an advantageous host for recombinant protein expression?

C. glutamicum is a non-pathogenic, Gram-positive soil bacterium that offers several advantages as an expression host for recombinant proteins. It possesses a naturally high secretion capacity, lacks significant extracellular proteolytic activity, and has GRAS (Generally Recognized As Safe) status. The bacterium is extensively used in industrial amino acid production and has well-established genetic manipulation tools .

C. glutamicum can be cultivated to high cell densities in simple mineral media with glucose as the sole carbon source. This characteristic makes it particularly suitable for laboratory-scale experiments and potential scale-up processes. Unlike some expression systems, C. glutamicum does not produce endotoxins, making downstream processing less complex for certain applications .

What are the key considerations for designing expression vectors for C. glutamicum?

When designing expression vectors for C. glutamicum, researchers should consider:

  • Promoter selection: Leaderless promoters like PH36, PH30, and Pcg0124 have been shown to provide precise control of gene expression in C. glutamicum . Traditional promoters containing 5′UTR (such as Ptac, Paph, and Ptuf) can also be used depending on the desired expression level.

  • Codon optimization: Adapting the coding sequence to the codon usage bias of C. glutamicum can significantly improve expression levels.

  • Vector backbone: Plasmids like pbtac-HP-1 have been successfully used as skeletons for construct development .

  • Restriction sites: When designing cloning strategies, consider available restriction sites and plan for their removal if necessary, as done with HindIII sites in some constructs .

  • Cistron design: For fine-tuned expression, bicistronic designs with fore-cistrons can be employed to modulate translation efficiency .

How can I optimize the expression of recombinant UppP in C. glutamicum using bicistronic design strategies?

Leaderless bicistronic design (BCD) represents an advanced approach for precise control of gene expression in C. glutamicum. To optimize UppP expression:

  • Select an appropriate leaderless promoter: PH36 promoter (95 bp) has shown reliable activity in C. glutamicum and can be inserted into expression vectors using homologous recombination with linearized plasmid backbones like pbtac-HP-1 (EcoRV/HindIII) .

  • Design an effective fore-cistron: A 62 bp fore-cistron sequence can be obtained by primer annealing and inserted alongside the promoter. The fore-cistron modulates translation of the downstream gene of interest (in this case, uppP) .

  • Systematically test variants: Create a series of constructs with variations in:

    • Start codon choices in the fore-cistron

    • Shine-Dalgarno (SD) sequence modifications

    • Spacing between regulatory elements

  • Compare with monocistronic designs: For reference, construct a monocistronic expression cassette where the promoter is directly ligated to the linearized vector .

The BCD approach provides more predictable and reliable expression levels compared to traditional designs with 5'UTRs, allowing for fine-tuning of UppP production.

What approaches can be used to address potential toxic effects of UppP overexpression?

Overexpression of membrane proteins like UppP can cause cellular stress. Consider these strategies:

  • Inducible expression systems: Use tightly controlled inducible promoters to regulate expression timing and level.

  • Combinatorial promoter-UTR (PUTR) design: Integrate strong transcriptional promoters with translational 5'-UTRs to create balanced expression. Systems like PssrA-UTRrpsT or PdnaKJ-UTRrpsT have demonstrated high activity while maintaining cellular viability .

  • Cascade PUTRs: More sophisticated expression control can be achieved with cascade PUTRs (such as PUTRssrA-PUTRinfC-rplT), which provided expression outputs of up to 409% compared to reference promoters .

  • Co-expression of chaperones: Consider co-expressing molecular chaperones to assist in proper folding of recombinant UppP.

  • Growth condition optimization: Adjust cultivation temperature, medium composition, and induction timing to minimize toxicity while maximizing functional protein yield.

How can advanced experimental design principles be applied to characterize UppP activity in C. glutamicum?

Robust experimental design is crucial for reliable characterization of UppP activity:

  • Define clear variables:

    • Independent variable: Expression level of UppP (controlled by promoter strength, induction conditions)

    • Dependent variable: UppP enzymatic activity, cell wall integrity, or antibiotic resistance

    • Extraneous variables: Growth conditions, cell density, extraction methods

  • Develop specific, testable hypotheses: For example, "Increased expression of UppP will result in altered sensitivity to cell wall-targeting antibiotics."

  • Design experimental treatments: Create a gradient of UppP expression levels using different promoters or induction conditions .

  • Assign proper experimental groups:

    • Between-subjects design: Compare different strains expressing UppP variants

    • Within-subjects design: Measure the same strain under different conditions

  • Establish appropriate measurement methods: Develop biochemical assays to directly quantify UppP activity using purified protein or membrane fractions.

  • Control for confounding variables: Include wild-type controls, empty vector controls, and inactive UppP mutants to ensure observed effects are specifically due to UppP activity .

What is the recommended protocol for plasmid construction to express recombinant UppP in C. glutamicum?

Based on established methodologies for C. glutamicum protein expression, the following protocol is recommended:

  • Select an appropriate plasmid backbone: Use vectors like pbtac-HP-1 that have been successfully employed for C. glutamicum protein expression .

  • Prepare vector linearization:

    • Digest the plasmid with appropriate restriction enzymes (e.g., EcoRV/HindIII)

    • Purify the linearized vector using gel extraction

  • Design and prepare gene-specific components:

    • Design primers to amplify the uppP gene with appropriate fusion sites

    • If using a leaderless promoter approach, prepare the promoter fragment (e.g., 95 bp PH36) and fore-cistron sequence (62 bp) by primer annealing

  • Assembly method:

    • Use homologous recombination for inserting the promoter and fore-cistron into linearized vector

    • Alternatively, employ Gibson assembly or standard ligation procedures according to established protocols

  • Transformation and verification:

    • Transform constructs first into E. coli JM109 for verification and plasmid amplification

    • Confirm successful construction by restriction analysis and sequencing

    • Transform verified plasmids into C. glutamicum by electroporation

  • Selection and maintenance:

    • Use appropriate antibiotics for selection based on the plasmid's resistance marker

    • Maintain cultures under selection pressure to ensure plasmid retention

What methods are effective for purification and activity assessment of recombinant UppP from C. glutamicum?

For purification and activity assessment of recombinant UppP:

  • Cell disruption and membrane preparation:

    • Harvest cells in exponential or early stationary phase

    • Disrupt cells by methods such as sonication or French press

    • Isolate membrane fractions by differential centrifugation

  • Protein solubilization and purification:

    • Solubilize membrane proteins using appropriate detergents

    • Purify His-tagged UppP using Ni-NTA affinity chromatography

    • Consider size exclusion chromatography to determine oligomeric state (similar to how CrtE was determined to be active as a homodimer and IdsA as a homotetramer)

  • Activity assay setup:

    • Develop an assay to measure dephosphorylation of undecaprenyl pyrophosphate

    • Quantify released phosphate or remaining substrate

    • Include appropriate controls (heat-inactivated enzyme, no-enzyme controls)

  • Kinetic analysis:

    • Determine enzyme kinetics parameters (Km, Vmax, kcat)

    • Assess catalytic efficiency with various substrates and conditions

    • Compare with known enzymes like IdsA and CrtE, which showed highest catalytic efficiency with specific substrate combinations

  • Verification methods:

    • Confirm protein expression by immunoblot analysis

    • Verify activity through enzyme assays

    • Characterize the purified protein by SDS-PAGE, native PAGE, and mass spectrometry

How can I develop a reliable quantification method for intracellular and extracellular levels of UppP substrates and products?

To quantify UppP substrates and products:

  • Sample preparation:

    • For intracellular measurements: Separate cells from culture media by centrifugation

    • For extracellular measurements: Collect culture supernatant

    • Extract lipid components using appropriate solvent systems

  • Analytical techniques:

    • HPLC or LC-MS/MS for separation and detection of undecaprenyl compounds

    • Use methods similar to those employed for UDP-GlcNAc quantification, which successfully measured both intracellular (up to 14 mM) and extracellular (up to 60 mg/L) concentrations

  • Standard curve development:

    • Prepare standard curves using purified compounds

    • Ensure linearity across the expected concentration range

  • Normalization approaches:

    • For intracellular measurements: Normalize to cell dry weight or protein content

    • For extracellular measurements: Express as concentration in culture medium

  • Validation:

    • Include appropriate internal standards

    • Perform recovery experiments to assess extraction efficiency

    • Conduct replicate measurements to ensure reproducibility

How should I design experiments to compare different promoter systems for optimal UppP expression in C. glutamicum?

When comparing promoter systems for UppP expression:

Experimental PhaseKey ComponentsConsiderations
Design PhaseVariable selectionIndependent: Promoter type (leaderless vs. traditional with 5'UTR)
Dependent: UppP expression level, enzymatic activity
Extraneous: Growth phase, media composition
Hypothesis formulation"Leaderless promoters will provide more precise control of UppP expression compared to traditional promoters with 5'UTR"
Treatment designTest multiple promoters: PH36, PH30, Pcg0124 (leaderless)
Ptac, Paph, Ptuf (traditional with 5'UTR)
ImplementationGroup assignmentBetween-subjects design comparing different strains
Measurement methodProtein level: Western blot, activity assays
Transcript level: RT-qPCR
AnalysisData collectionMeasure at multiple time points during growth
Statistical analysisANOVA for multi-group comparison
Post-hoc tests for pairwise comparisons
ControlsEmpty vector, housekeeping gene promoter

What strategies can help troubleshoot low UppP activity in recombinant C. glutamicum strains?

When facing low UppP activity, consider these troubleshooting approaches:

  • Expression level assessment:

    • Verify transcription by RT-qPCR

    • Confirm translation by Western blot or mass spectrometry

    • Compare expression during exponential vs. stationary phase (differences of up to 20-fold in intracellular concentration have been observed for other recombinant proteins)

  • Protein solubility and localization:

    • Determine if UppP is correctly localized to the membrane

    • Assess potential aggregation or inclusion body formation

    • Optimize membrane isolation procedures

  • Enzymatic activity optimization:

    • Test different buffer conditions and pH values

    • Evaluate cofactor requirements

    • Assess the effect of different detergents on enzyme stability and activity

  • Genetic optimization approaches:

    • Try alternative expression systems (similar to the comparison of GlcNCg1, GlcNCg3, and GlcNCg4 strains, which showed dramatically different production levels)

    • Consider co-expression of chaperones or folding modulators

    • Evaluate the impact of competing pathways (similar to how deletion of nagB improved production in other C. glutamicum systems)

  • Process parameter optimization:

    • Adjust cultivation temperature

    • Modify media composition

    • Optimize induction timing and concentration

How do I interpret contradictory results when comparing different C. glutamicum strains for UppP expression?

When facing contradictory results across different strains:

  • Systematic variation analysis:

    • Identify key variables that differ between experiments (media, temperature, plasmid copy number)

    • Design factorial experiments to test interactions between variables

    • Develop a standardized protocol to minimize variability

  • Growth phase considerations:

    • Compare results from exponential vs. stationary phase cells

    • In some cases, dramatic differences (up to 20-fold) in intracellular protein concentration have been observed between growth phases

    • Extracellular protein levels may increase in stationary phase due to cell lysis or active secretion

  • Strain-specific factors:

    • Evaluate genetic background differences

    • Consider genomic integration site effects vs. plasmid-based expression

    • Examine potential regulatory network interactions

  • Protein detection methodology:

    • Compare different protein quantification methods

    • Ensure antibodies have comparable affinity across variants

    • Validate activity assays with purified standards

  • Statistical robustness:

    • Increase biological and technical replicates

    • Apply appropriate statistical tests for small sample sizes

    • Calculate effect sizes to determine practical significance

How can C. glutamicum UppP be engineered for enhanced substrate specificity or activity?

Engineering UppP for improved properties requires:

  • Structure-guided mutagenesis:

    • Identify conserved catalytic residues through sequence alignment

    • Target active site residues for site-directed mutagenesis

    • Explore loop regions that may influence substrate binding

  • Domain-swapping approaches:

    • Create chimeric proteins with domains from related phosphatases

    • Test domain-swapping constructs for altered specificity

    • Validate functional changes through enzymatic assays

  • Rational design strategies:

    • Implement computational modeling to predict beneficial mutations

    • Focus on residues involved in substrate recognition

    • Design mutations that may enhance catalytic efficiency

  • High-throughput screening systems:

    • Develop selection or screening methods linked to UppP activity

    • Create reporter systems that correlate with phosphatase activity

    • Screen libraries of UppP variants for desired properties

  • Protein stabilization approaches:

    • Identify destabilizing regions through thermal shift assays

    • Introduce disulfide bridges or salt bridges for enhanced stability

    • Optimize surface charge distribution for improved solubility

What considerations are important when designing experiments to study UppP interactions with cell wall biosynthesis machinery?

When studying UppP interactions with other cell wall biosynthesis components:

  • Protein-protein interaction methods:

    • Bacterial two-hybrid systems

    • Co-immunoprecipitation assays

    • Crosslinking approaches

    • Fluorescence resonance energy transfer (FRET)

  • Membrane protein complex isolation:

    • Blue native PAGE for intact complex separation

    • Detergent selection critical for maintaining native interactions

    • Gradient ultracentrifugation for complex purification

  • Genetic interaction studies:

    • Synthetic genetic arrays to identify genetic interactions

    • Suppressor screening to identify functional relationships

    • Conditional depletion systems to study essential gene interactions

  • Localization studies:

    • Fluorescent protein fusions to track subcellular localization

    • Super-resolution microscopy for detailed spatial analysis

    • Time-lapse imaging to capture dynamic interactions

  • Metabolic flux analysis:

    • Radiolabeled precursor incorporation studies

    • Measurement of metabolic intermediates

    • Comparison between wild-type and UppP-modified strains

How does UppP expression in C. glutamicum compare with other bacterial expression systems?

A comparative analysis of expression systems reveals:

Expression SystemAdvantagesLimitationsRelevance to UppP
C. glutamicum- Gram-positive with simple cell wall
- GRAS status
- Minimal proteolytic activity
- High secretion capacity
- Growth on simple minimal media
- Lower transformation efficiency
- Fewer genetic tools than E. coli
- Natural producer of cell wall components
- Physiologically relevant host for UppP
E. coli- Well-established genetic tools
- High transformation efficiency
- Rapid growth
- Endotoxin production
- Inclusion body formation
- Different cell wall architecture
- More challenging for membrane protein expression
- May require specialized strains
L. casei- Alternative Gram-positive host
- Probiotic properties
- Slower growth
- More complex media requirements
- Lower expression levels reported compared to optimized C. glutamicum systems
B. subtilis- High secretion capacity
- Well-characterized Gram-positive
- High extracellular protease activity
- Plasmid instability
- Alternative for Gram-positive expression
- Requires protease-deficient strains

C. glutamicum offers particular advantages for UppP research due to its similarity to pathogenic mycobacteria in cell wall composition while maintaining GRAS status and ease of manipulation. The optimized expression systems in C. glutamicum have demonstrated up to 50-fold increases in recombinant protein levels compared to baseline strains .

What are the key differences between studying UppP in vitro versus in vivo in C. glutamicum?

Understanding the distinctions between in vitro and in vivo approaches:

AspectIn Vitro ApproachIn Vivo Approach
Enzyme PurityHighly purified protein preparationsNative cellular environment
Activity MeasurementDirect measurement of catalytic parametersIndirect assessment through phenotypic changes
Substrate AccessibilityControlled substrate concentrationsNatural substrate levels with competing pathways
Experimental ControlHigh control over reaction conditionsLimited control over cellular conditions
Physiological RelevanceLimited by artificial conditionsHigh physiological relevance
Technical ComplexityComplex purification proceduresChallenging phenotypic analyses
Data InterpretationStraightforward kinetic analysesComplex due to multiple cellular factors
Application in ResearchMechanistic understanding
Structure-function relationships
Cellular role
Physiological importance

For comprehensive UppP characterization, both approaches are complementary. In vitro studies with purified protein (similar to those conducted with CrtE and IdsA) provide precise biochemical parameters , while in vivo studies reveal the physiological impact and regulatory networks affecting UppP function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.