Recombinant Corynebacterium jeikeium ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpF; jk1339; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-186
Protein Length
full length protein
Species
Corynebacterium jeikeium (strain K411)
Target Names
atpF
Target Protein Sequence
MTNTFLLAAEKLPMEESVNPLIPPLYDIVWSIIPFAVILFVFWKFVLPKFQEVLNQREDQ IEGGIRRAESAQAEAKAALEKYNAQLAEARTEAAQIRDDARSQGQKIIADMKAQATEESN RIVESGHKQLEAQRSAVVTDLRKEMGENSINLAERLLGEQLSDDVKRSGTIDNFLAGLDN VGASGK
Uniprot No.

Target Background

Function

F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the extramembranous catalytic F1 domain and the membrane-bound proton channel F0 domain, connected by a central and peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled to proton translocation via a rotary mechanism involving the central stalk subunits.

This protein is a component of the F0 channel, forming part of the peripheral stalk, which links F1 and F0.

Database Links

KEGG: cjk:jk1339

STRING: 306537.jk1339

Protein Families
ATPase B chain family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is the role of ATP synthase subunit b (atpF) in Corynebacterium jeikeium?

ATP synthase subunit b (atpF) in Corynebacterium jeikeium is a structural component of the F₀ domain of ATP synthase. It functions as part of the stator stalk, connecting the membrane-embedded F₀ domain with the catalytic F₁ domain. This connection is essential for maintaining the structural integrity of the ATP synthase complex during the rotational catalysis mechanism. Unlike the catalytic subunits (α and β) that directly participate in ATP synthesis, the b subunit plays a crucial structural role, helping to anchor the stationary parts of the enzyme during the rotational movement of other components that drives ATP synthesis .

What is known about the expression pattern of ATP synthase in Corynebacterium jeikeium under different growth conditions?

ATP synthase expression in Corynebacterium jeikeium, including subunit b, is regulated in response to energy demands and environmental conditions. The organism typically upregulates ATP synthase expression under aerobic conditions where oxidative phosphorylation is the primary ATP generation method. Under oxygen limitation or nutrient stress, expression patterns may shift as the bacterium adjusts its energy metabolism. Research methodologies to study these expression patterns include qRT-PCR to measure gene expression levels, proteomics to quantify protein abundance, and reporter gene assays to monitor promoter activity under different growth conditions. Experimental approaches should include careful control of growth parameters (pH, temperature, nutrient availability) and sampling at multiple time points to capture dynamic expression changes .

What are the optimal conditions for expressing recombinant Corynebacterium jeikeium ATP synthase subunit b in heterologous systems?

The optimal expression of recombinant Corynebacterium jeikeium ATP synthase subunit b (atpF) requires careful optimization of several parameters. Based on similar membrane protein expression studies, the following methodological approach is recommended:

Expression Systems:

  • E. coli BL21(DE3) or C41(DE3) strains are often suitable for membrane protein expression

  • Alternatively, consider yeast systems (Pichia pastoris) for complex membrane proteins

Expression Conditions:

  • Induction at lower temperatures (16-20°C) often improves proper folding

  • Extended expression times (16-24 hours) at reduced inducer concentrations

  • Supplementation with membrane-supporting components (e.g., 0.5-1% glucose)

Vector Selection:

  • Vectors with tightly regulated promoters (T7 lac or tac)

  • Consider fusion tags that enhance solubility (MBP, SUMO) with cleavable linkers

  • C-terminal His-tags often perform better than N-terminal tags for membrane proteins

Optimization should involve small-scale expression trials testing multiple conditions simultaneously, followed by Western blot analysis to confirm expression and proper folding before scaling up .

What structural biology techniques are most appropriate for studying the 3D conformation of ATP synthase subunit b in Corynebacterium jeikeium?

Several complementary structural biology techniques can be employed to elucidate the 3D conformation of ATP synthase subunit b in Corynebacterium jeikeium:

Cryo-electron Microscopy (Cryo-EM):

  • Particularly valuable for membrane protein complexes

  • Can resolve structures at near-atomic resolution (2-4 Å)

  • Requires minimal sample amounts compared to crystallography

  • Allows visualization of different conformational states

X-ray Crystallography:

  • Offers highest resolution when crystals can be obtained

  • Challenging for membrane proteins but possible with lipidic cubic phase approaches

  • May require truncation constructs focusing on soluble domains

NMR Spectroscopy:

  • Suitable for studying dynamic regions and protein-protein interactions

  • Solution NMR for isolated domains; solid-state NMR for membrane-embedded portions

  • Can provide information on local structure and dynamics

Small-Angle X-ray Scattering (SAXS):

  • Provides low-resolution envelope of protein structure in solution

  • Useful for validating models and studying conformational changes

  • Similar to the approach used for subunit α characterization in Mycobacterium

Integrative structural biology approaches combining multiple techniques yield the most comprehensive insights into structure and function relationships.

How can site-directed mutagenesis be utilized to investigate the functional roles of specific residues in ATP synthase subunit b?

Site-directed mutagenesis provides a powerful approach to probe structure-function relationships in ATP synthase subunit b:

Methodological Approach:

  • Target Selection: Identify conserved residues through multiple sequence alignments across bacterial species

  • Mutation Design: Create conservative substitutions (similar properties) and non-conservative substitutions (altered properties)

  • Mutagenesis Technique: Use overlap extension PCR or QuikChange methods for introducing mutations

  • Functional Assays:

    • ATP synthesis/hydrolysis assays using purified protein in liposomes

    • Proton pumping measurements using pH-sensitive fluorescent dyes

    • Growth complementation assays in ATP synthase-deficient strains

Key Residue Categories to Target:

  • Membrane-spanning residues that may participate in proton translocation

  • Interface residues that interact with other subunits

  • Structural residues that maintain the stator stalk conformation

Analysis of Mutants:

  • Compare enzymatic parameters (Km, Vmax, coupling efficiency)

  • Assess structural integrity through circular dichroism or thermal stability assays

  • Evaluate assembly competence through blue native PAGE

This approach parallels the strategy used to understand the role of the C-terminal domain in mycobacterial subunit α, where deletion mutants revealed increased ATP hydrolysis and proton-pumping activity .

What are the best approaches for purifying functional Corynebacterium jeikeium ATP synthase complexes containing the recombinant subunit b?

Purification of functional ATP synthase complexes containing recombinant subunit b requires careful consideration of membrane protein biochemistry:

Solubilization Strategy:

  • Test multiple detergents (DDM, LMNG, digitonin) at various concentrations

  • Consider gentle solubilization at 4°C for extended periods (2-4 hours)

  • Include ATP and Mg²⁺ to stabilize the complex during extraction

Purification Protocol:

  • Membrane Preparation:

    • Cell disruption by French press or sonication

    • Differential centrifugation to isolate membrane fraction (100,000 × g)

  • Affinity Chromatography:

    • Nickel-NTA for His-tagged constructs

    • Use gradual imidazole gradients (20-250 mM) for selective elution

  • Size Exclusion Chromatography:

    • Superdex 200 or Superose 6 columns to isolate intact complexes

    • Buffer containing low detergent concentration and stabilizing additives (glycerol, ATP)

  • Functional Verification:

    • ATP synthesis assay using artificial proton gradient

    • ATP hydrolysis measurement with released phosphate detection

Reconstitution:

  • Incorporate purified protein into liposomes using detergent removal methods

  • Test functionality through ATP synthesis or proton pumping assays

This approach is similar to strategies used for other bacterial ATP synthases, with modifications specific to the properties of Corynebacterium membrane proteins .

How can isotope labeling be used to study the interaction between ATP synthase subunit b and other components of the ATP synthase complex?

Isotope labeling provides powerful tools for investigating protein-protein interactions within the ATP synthase complex:

NMR-Based Approaches:

  • Express recombinant subunit b with ¹⁵N and/or ¹³C labeling in minimal media

  • Perform chemical shift perturbation experiments upon addition of interaction partners

  • Use TROSY-based experiments for larger assemblies to improve spectral quality

  • Map interaction surfaces through selective isotope labeling of specific residues

Mass Spectrometry Approaches:

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to identify protected regions

  • Cross-linking mass spectrometry (XL-MS) using isotope-coded cross-linkers

  • Protocol should include:

    • Controlled partial deuteration of the complex

    • Enzymatic digestion and MS/MS analysis

    • Identification of peptides with reduced deuterium uptake (interaction sites)

Experimental Design Table:

TechniqueIsotope LabelInformation ObtainedResolution Level
2D NMR¹⁵NBackbone interaction sitesResidue-specific
3D NMR¹⁵N, ¹³CSide chain contactsAtomic
HDX-MSDeuteriumProtected regionsPeptide-level
XL-MSIsotope-coded linkersDistance constraintsCross-linked residues

This combination of techniques can provide detailed maps of the structural arrangement of subunit b within the ATP synthase complex, similar to the structural studies performed on mycobacterial subunit α .

What controls should be included when studying the effects of Corynebacterium jeikeium ATP synthase subunit b mutations on enzyme function?

Rigorous control experiments are essential when investigating the functional effects of ATP synthase subunit b mutations:

Essential Controls:

  • Wild-type Comparison:

    • Always include parallel analysis of wild-type protein under identical conditions

    • Prepare wild-type and mutant proteins simultaneously to eliminate batch effects

  • Expression and Purification Controls:

    • Verify equivalent expression levels through quantitative Western blotting

    • Assess protein folding integrity via circular dichroism spectroscopy

    • Confirm complex assembly through blue native PAGE or analytical ultracentrifugation

  • Functional Assay Controls:

    • Include known inhibitors (oligomycin, DCCD) as positive controls for assay specificity

    • Perform substrate-free and enzyme-free control reactions

    • Include uncoupled controls (e.g., ionophores) to test coupling efficiency

  • Stability Controls:

    • Thermal stability assays to ensure mutations don't simply destabilize the protein

    • Time-course activity measurements to account for differential stability

  • System-Specific Controls:

    • If using heterologous expression, compare with native complex when possible

    • For in vivo studies, complement with plasmid-encoded wild-type as positive control

These control experiments are particularly important when interpreting subtle functional changes, similar to the careful controls used in the studies of mycobacterial ATP synthase, where both deletion mutants and chimeric constructs were compared to wild-type enzymes .

How should researchers interpret discrepancies between in vitro and in vivo functional assays of ATP synthase containing mutant subunit b?

Discrepancies between in vitro and in vivo functional assays are common when studying ATP synthase and require careful analysis:

Sources of Discrepancies:

  • Environmental Differences:

    • In vitro systems lack the complex physiological environment of cells

    • Membrane composition differences affect enzyme function

    • The proton motive force may differ between artificial systems and living cells

  • Complex Assembly:

    • In vitro reconstitution may not fully replicate native assembly

    • Partial complexes may function differently than complete assemblies

    • Stoichiometry of subunits may vary between systems

  • Regulatory Factors:

    • In vivo systems contain regulatory proteins absent in purified systems

    • Post-translational modifications present in vivo may be missing in vitro

    • Cellular metabolic state influences ATP synthase function

Interpretation Framework:

  • Complementary Value: View in vitro and in vivo results as complementary rather than contradictory

  • Mechanistic Insights: Use in vitro data to understand molecular mechanisms

  • Physiological Relevance: Use in vivo data to assess biological significance

  • Bridge Experiments: Design experiments that bridge the gap (e.g., cell extracts, spheroplasts)

Resolution Strategies:

  • Systematically vary in vitro conditions to approach physiological environment

  • Develop more sophisticated in vitro systems incorporating additional cellular components

  • Use genetic approaches to test mechanistic hypotheses derived from in vitro studies

This careful interpretation approach is similar to that used in studies of mycobacterial ATP synthase, where both isolated enzyme studies and membrane vesicle experiments were conducted to understand the role of the C-terminal domain .

What statistical approaches are most appropriate for analyzing kinetic data from ATP synthase activity assays?

Proper statistical analysis of ATP synthase kinetic data requires specialized approaches:

Kinetic Parameter Estimation:

  • Non-linear Regression:

    • Fit data to appropriate enzyme kinetic models (Michaelis-Menten, Hill, etc.)

    • Use software that provides confidence intervals for parameters (Km, Vmax)

    • Compare models using Akaike Information Criterion (AIC) or F-test

  • Progress Curve Analysis:

    • For time-course data, use integrated rate equations rather than initial rates

    • Account for product inhibition and substrate depletion

    • Consider global fitting of multiple progress curves simultaneously

Statistical Comparison of Enzymes:

  • Parameter Comparison:

    • Use extra sum-of-squares F-test to compare kinetic parameters between enzymes

    • For multiple comparisons, apply Bonferroni or false discovery rate corrections

    • Report effect sizes (percent difference) along with p-values

  • Experimental Design Considerations:

    • Power analysis to determine sample size requirements

    • Nested designs to account for batch-to-batch variation

    • Randomization of sample order to minimize systematic errors

Data Presentation:

Analysis ApproachWhen to UseStatistical Output
Michaelis-MentenSimple substrate kineticsKm, Vmax with 95% CI
Product inhibitionATP/ADP ratio effectsKi values with SE
Proton-pumpingpmf-dependent activityH⁺/ATP coupling ratio
Hill equationCooperative bindingHill coefficient (n)

These statistical approaches provide rigorous assessment of functional differences, similar to the methods used to quantify the 12% decrease in ATPase activity observed when the mycobacterial C-terminal extension was transplanted onto a standard F-ATP synthase α subunit .

How can researchers differentiate between effects on ATP synthesis versus ATP hydrolysis when studying ATP synthase subunit b mutations?

Differentiating between effects on ATP synthesis and hydrolysis requires specialized experimental design:

Methodological Approaches:

  • Directional Assays:

    • Synthesis: Measure ATP production using luciferase in the presence of ADP, Pi and proton gradient

    • Hydrolysis: Measure Pi release from ATP using colorimetric assays (malachite green, MESG)

    • Compare rates under identical enzyme concentrations and buffer conditions

  • Thermodynamic Control:

    • Vary ΔG of ATP hydrolysis by adjusting [ATP]/[ADP][Pi] ratios

    • Plot activity versus ΔG to determine effect on reversibility

    • Identify shifts in the equilibrium point where synthesis equals hydrolysis

  • Coupling Efficiency:

    • Simultaneously measure ATP hydrolysis and proton translocation

    • Calculate H⁺/ATP ratios for both synthesis and hydrolysis directions

    • Identify mutations that affect coupling rather than catalysis

Analysis Framework:

  • Catalytic Effects: Similarly impact both directions, maintaining the synthesis/hydrolysis ratio

  • Coupling Effects: Differentially impact synthesis versus hydrolysis

  • Regulatory Effects: May selectively inhibit hydrolysis while permitting synthesis

Experimental Illustration:
The C-terminal domain of mycobacterial subunit α specifically suppresses ATP hydrolysis without equivalently affecting synthesis, representing a regulatory effect rather than a catalytic one. Similar regulatory elements might exist in Corynebacterium jeikeium ATP synthase that differentially affect the two directions of the reaction .

What are common pitfalls in recombinant expression of ATP synthase subunit b, and how can they be addressed?

Recombinant expression of ATP synthase subunit b presents several challenges that researchers should anticipate and address:

Expression Challenges:

  • Toxicity to Host Cells:

    • Problem: Overexpression disrupts host membrane integrity

    • Solution: Use tightly regulated expression systems with inducible promoters

    • Method: Employ C41/C43(DE3) E. coli strains specifically evolved for membrane protein expression

  • Inclusion Body Formation:

    • Problem: Improper folding leads to aggregation

    • Solution: Lower temperature (16-20°C), reduce inducer concentration

    • Method: Consider fusion partners (MBP, SUMO) that enhance solubility

  • Proteolytic Degradation:

    • Problem: Unstable recombinant protein degraded by host proteases

    • Solution: Include protease inhibitors, use protease-deficient strains

    • Method: Design constructs that mask protease recognition sites

Purification Challenges:

  • Detergent Selection:

    • Problem: Inappropriate detergents cause denaturation or aggregation

    • Solution: Screen multiple detergents (DDM, LMNG, digitonin)

    • Method: Use thermostability assays to identify optimal detergent conditions

  • Co-purifying Contaminants:

    • Problem: Host membrane proteins co-purify with target

    • Solution: Implement multi-step purification strategy

    • Method: Combine affinity chromatography with ion exchange and size exclusion steps

  • Loss of Associated Lipids:

    • Problem: Stripping essential lipids affects function

    • Solution: Add specific lipids during purification

    • Method: Consider amphipol or nanodisc reconstitution to maintain native-like environment

These approaches are based on experience with similar membrane proteins, including ATP synthase components from various bacterial species .

How can researchers address the challenge of assessing ATP synthase assembly when introducing recombinant or mutant subunit b?

Assessing proper assembly of ATP synthase complexes containing recombinant or mutant subunit b requires specialized approaches:

Assembly Assessment Techniques:

  • Blue Native PAGE:

    • Method: Solubilize membranes in mild detergent, separate on gradient gels

    • Analysis: Compare migration of complexes containing wild-type versus mutant subunit b

    • Extension: Combine with Western blotting to confirm subunit composition

  • Analytical Ultracentrifugation:

    • Method: Sedimentation velocity analysis of purified complexes

    • Analysis: Compare sedimentation coefficients to detect assembly defects

    • Advantage: Provides quantitative measure of complex homogeneity

  • Crosslinking Mass Spectrometry:

    • Method: Chemical crosslinking followed by MS/MS analysis

    • Analysis: Identify crosslinked peptides representing subunit interfaces

    • Application: Compare crosslinking patterns between wild-type and mutant complexes

  • FRET-Based Assays:

    • Method: Label multiple subunits with FRET pairs

    • Analysis: Measure FRET efficiency as indicator of proper assembly

    • Application: Can be performed in membrane vesicles or reconstituted systems

Functional Confirmation:

  • ATP-Driven Proton Pumping:

    • Method: Monitor pH changes using fluorescent dyes (ACMA, pyranine)

    • Interpretation: Coupling of ATP hydrolysis to proton movement indicates proper assembly

    • Control: Include uncouplers to confirm specificity

  • ATP Synthesis Assay:

    • Method: Generate artificial proton gradient and measure ATP production

    • Interpretation: ATP synthesis requires correctly assembled complex

    • Similar to approaches used in the study of mycobacterial ATP synthase

What strategies can overcome the challenge of low protein yields when studying ATP synthase subunit b from Corynebacterium jeikeium?

Low protein yields are a common challenge when working with membrane proteins like ATP synthase subunit b. Several strategies can address this limitation:

Expression Optimization:

  • Codon Optimization:

    • Adapt codons to expression host preferences

    • Remove rare codons and optimize GC content

    • Synthetic genes often yield better expression than native sequences

  • Expression Host Selection:

    • Consider alternative hosts (Lactococcus, Bacillus, Brevibacillus)

    • Test eukaryotic systems (Pichia pastoris, insect cells) for difficult proteins

    • Homologous expression in related Corynebacterium species

  • Growth Conditions:

    • Test rich media formulations with supplements (glycerol, glucose)

    • Optimize cell density at induction time

    • Consider fed-batch cultivation for higher biomass

Purification Yield Improvement:

  • Extraction Efficiency:

    • Screen multiple detergent combinations and concentrations

    • Test different solubilization times and temperatures

    • Consider novel solubilization agents (SMALPs, nanodiscs)

  • Stability Enhancement:

    • Add stabilizing agents (glycerol, specific lipids, nucleotides)

    • Optimize buffer conditions (pH, ionic strength, specific ions)

    • Minimize handling time and maintain cold temperature

  • Alternative Approaches:

    • Focus on functional domains rather than full-length protein

    • Consider cell-free expression systems for toxic proteins

    • Use peptide synthesis for specific regions of interest

Functional Analysis with Limited Material:

  • Miniaturized Assays:

    • Adapt assays to microplate format

    • Employ fluorescence-based detection for increased sensitivity

    • Consider single-molecule techniques that require minimal sample

  • Amplification Strategies:

    • Couple enzyme activity to cycling reactions

    • Use bioluminescence detection for ultimate sensitivity

    • Develop reconstitution systems requiring minimal protein input

These strategies can help overcome yield limitations while still generating high-quality data on structure-function relationships .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.