Recombinant Corynebacterium jeikeium Protein CrcB homolog 1 (crcB1)

Shipped with Ice Packs
In Stock

Description

Production and Purification

The protein is produced via heterologous expression in E. coli, followed by nickel-affinity chromatography. Critical steps include:

  1. Expression: Induced under optimized conditions for soluble protein yield .

  2. Lyophilization: Stabilized with trehalose to prevent aggregation .

  3. Quality control: Validated by SDS-PAGE and mass spectrometry .

Reconstitution requires brief centrifugation to pellet insoluble aggregates, with glycerol (5–50%) recommended for long-term storage .

Genomic and Evolutionary Context

The crcB1 gene resides in a 2.46 Mb chromosome with 61.4% GC content . Comparative genomics reveals:

  • Orthologs: Limited conservation across Corynebacterium species, with no direct orthologs in C. glutamicum or C. diphtheriae .

  • Horizontal transfer: Unlikely, as crcB1 is absent from plasmid pKW4 (a bacteriocin-encoding plasmid in C. jeikeium) .

Research Applications

  1. Antimicrobial studies: Fluoride transporters are potential targets for novel antibacterials .

  2. Structural biology: The small size and solubility of recombinant CrcB1 facilitate crystallization trials .

  3. Diagnostics: As a species-specific antigen for C. jeikeium detection in clinical samples .

Limitations and Future Directions

Current data gaps include:

  • Direct experimental validation of fluoride transport activity.

  • Structural resolution (e.g., cryo-EM or X-ray crystallography).

  • Role in C. jeikeium pathogenicity, given its association with bacteremia in immunocompromised hosts .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we accommodate specific format requests. Please clearly indicate your preference when placing the order, and we will fulfill it accordingly.
Lead Time
Delivery timelines may vary based on the purchasing method and location. For precise delivery estimates, please consult your local distributors.
Note: All protein shipments default to standard blue ice packs. For dry ice shipment, please inform us in advance; additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize development according to your specifications.
Synonyms
crcB1; jk2058; Putative fluoride ion transporter CrcB 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-140
Protein Length
full length protein
Species
Corynebacterium jeikeium (strain K411)
Target Names
crcB1
Target Protein Sequence
MNTGATLIELLAVALGGGTGAAARYVLDTHLKSKHGWAPLWSLAVVNLLGTVVLGLVLGY TSQHLDGAAGSTSAGETQDILYPLLGIGLAGGFTTFSTVMVEVFTRPQPARRIAGVVGMA VVCCAVFLPALWCGALLAGA
Uniprot No.

Target Background

Function
Plays a critical role in reducing fluoride concentration within the cell, thereby mitigating its toxicity.
Database Links

KEGG: cjk:jk2058

STRING: 306537.jk2058

Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What expression systems are recommended for producing recombinant CrcB1?

For optimal expression of recombinant CrcB1, an E. coli expression system is most commonly employed as evidenced by commercial preparations . When designing your expression protocol, consider these methodological aspects:

  • Vector selection: pET expression systems with T7 promoters offer high-yield production for membrane proteins like CrcB1

  • Expression strain optimization: BL21(DE3) or Rosetta strains typically show good expression for Corynebacterium proteins

  • Induction parameters: IPTG concentrations of 0.1-1.0 mM at lower temperatures (16-25°C) often improve folding

  • Fusion tags: N-terminal His-tags facilitate purification while maintaining protein functionality

The effectiveness of your expression system may be evaluated using SDS-PAGE analysis, with successful preparations typically achieving >90% purity .

What storage conditions maximize CrcB1 stability and functionality?

Maintaining protein stability is critical for experimental reproducibility. Based on manufacturer recommendations and standard protein handling protocols, the following storage conditions are advised:

Storage ParameterRecommended ConditionNotes
Long-term storage-20°C to -80°CAliquoting is necessary to avoid repeated freeze-thaw cycles
Buffer compositionTris-based buffer with 50% glycerolpH 8.0 is optimal for stability
Working conditionsStore aliquots at 4°CUse within one week
ReconstitutionDeionized sterile waterReconstitute to 0.1-1.0 mg/mL
Freeze-thaw cyclesMinimizeRepeated cycles significantly reduce activity

For lyophilized preparations, brief centrifugation before opening is recommended to bring contents to the bottom of the vial . The addition of 5-50% glycerol (with 50% being standard) to reconstituted protein significantly extends shelf-life during freezer storage.

What methodological approaches can detect CrcB1-protein interactions?

To investigate potential protein-protein interactions involving CrcB1, researchers may employ several complementary techniques:

  • Co-immunoprecipitation (Co-IP): Using anti-His antibodies to pull down His-tagged CrcB1 and identify interacting partners via mass spectrometry.

  • Bacterial two-hybrid systems: Particularly useful for membrane proteins like CrcB1 that may not fold properly in yeast two-hybrid systems.

  • Proximity-based labeling: Techniques such as BioID or APEX2 labeling can identify proximal proteins in the native cellular environment.

  • Cross-linking mass spectrometry (XL-MS): This approach can capture transient interactions and provide structural information about the interaction interface.

When reporting interaction results, include appropriate controls to distinguish specific from non-specific interactions, particularly important for membrane proteins that may exhibit hydrophobic associations.

What role might CrcB1 play in antimicrobial resistance mechanisms?

While CrcB1 itself has not been directly implicated in antimicrobial resistance in the available literature, the search results indicate that C. jeikeium harbors resistance mechanisms against β-lactam antibiotics through penicillin-binding proteins (PBPs), specifically Pbp2c . This suggests several research avenues for investigating potential connections:

  • Transcriptomic analysis: Determine whether crcB1 expression changes in response to antibiotic exposure, particularly fluoroquinolones or other antibiotics that might affect membrane potential.

  • Gene knockout studies: Generate crcB1 deletion mutants to assess changes in minimum inhibitory concentrations (MICs) for various antibiotic classes.

  • Ion homeostasis and antibiotic efficacy: Investigate whether altered fluoride ion transport affects membrane permeability to antibiotics or influences the proton motive force required for certain antibiotic uptake mechanisms.

C. jeikeium is known to exhibit multidrug resistance, with Pbp2c conferring "high levels of β-lactam resistance to the host" through "a β-lactam-induced regulatory system" . Similar regulatory mechanisms might also influence CrcB1 expression under antimicrobial pressure.

What structural characterization methods are suitable for membrane proteins like CrcB1?

Membrane proteins present unique challenges for structural determination. For CrcB1 research, consider these methodological approaches:

  • Cryo-electron microscopy (Cryo-EM): Particularly valuable for membrane proteins that resist crystallization, allowing visualization in near-native environments when incorporated into nanodiscs or liposomes.

  • X-ray crystallography: Requires specialized detergent screening and crystallization conditions. Consider lipidic cubic phase (LCP) crystallization which has proven successful for many membrane transporters.

  • Nuclear magnetic resonance (NMR) spectroscopy: Solution NMR can provide dynamic information, though size limitations may necessitate selective labeling strategies.

  • Molecular dynamics simulations: Computational approaches can predict structural features and ion permeation pathways based on homology models.

For any structural study, protein stability in detergent solutions must be rigorously assessed. Size-exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) can confirm monodispersity and appropriate oligomeric state prior to structural studies.

How can researchers design fluoride transport assays for CrcB1 functional studies?

To characterize the putative fluoride transport activity of CrcB1, researchers should consider these methodological approaches:

  • Liposome-based fluoride transport assays:

    • Reconstitute purified CrcB1 into liposomes

    • Load liposomes with a fluoride-sensitive dye (e.g., SBFI)

    • Monitor fluorescence changes upon addition of external fluoride

    • Include valinomycin controls to assess potential effects of membrane potential

  • Whole-cell fluoride accumulation assays:

    • Express CrcB1 in a heterologous host lacking endogenous fluoride transporters

    • Expose cells to various fluoride concentrations

    • Measure intracellular fluoride concentrations using ion-selective electrodes

    • Compare accumulation rates between CrcB1-expressing cells and controls

  • Patch-clamp electrophysiology:

    • For detailed biophysical characterization of ion transport kinetics

    • Can determine ion selectivity by measuring currents in different ionic conditions

    • Allows for testing of potential inhibitors

When reporting transport data, include appropriate negative controls (liposomes without protein or cells expressing inactive mutants) and positive controls (liposomes or cells expressing known fluoride transporters).

How can CrcB1 research contribute to understanding bacterial adaptation to environmental stress?

The putative function of CrcB1 as a fluoride ion transporter suggests its involvement in bacterial adaptation to environmental challenges. Future research might explore:

  • Environmental adaptation: Fluoride is naturally present in soil and water environments at varying concentrations. CrcB1 may play a crucial role in C. jeikeium adaptation to fluoride-rich environments.

  • Stress response networks: Investigating whether crcB1 expression is coordinated with other stress response genes could reveal integrated cellular defense mechanisms.

  • Comparative genomics approach: Analyzing the presence, absence, and variation of crcB1 genes across Corynebacterium species from different environmental niches may reveal evolutionary adaptations.

  • Host-pathogen interactions: As C. jeikeium is an opportunistic human pathogen, exploring whether CrcB1 contributes to survival during host colonization, particularly in response to host defense mechanisms that may alter ion concentrations, represents an important research direction.

What techniques can resolve contradictory findings in CrcB1 research?

When researchers encounter conflicting results regarding CrcB1 function or expression, these methodological approaches can help resolve discrepancies:

  • Standardized expression conditions: Variations in protein production protocols can significantly impact functional studies. Establish consistent expression and purification protocols across laboratories.

  • Strain verification: Confirm the genetic background of C. jeikeium strains, as different clinical isolates may exhibit variations in crcB1 sequence or regulation.

  • Multiple functional assays: Employ complementary techniques to assess function, such as combining transport assays with growth phenotypes under fluoride stress.

  • Collaborative cross-validation: Establish multi-laboratory validation studies with standardized protocols, materials, and data analysis pipelines.

  • Computational validation: Molecular dynamics simulations can help evaluate whether experimental observations are physically plausible based on protein structure.

Researchers should systematically document experimental conditions, including buffer compositions, protein concentrations, and assay temperatures, as these factors can significantly influence membrane protein behavior and lead to apparently contradictory results.

How might CrcB1 relate to other membrane transport systems in Corynebacterium jeikeium?

Understanding the relationship between CrcB1 and other transport systems requires an integrated research approach:

  • Co-expression analysis: Determine whether crcB1 expression correlates with other transporters under various environmental conditions.

  • Functional redundancy assessment: Generate single and combinatorial knockout mutants of crcB1 and related transporters to identify potential compensatory mechanisms.

  • Localization studies: Employ fluorescent protein fusions or immunolocalization to determine whether CrcB1 co-localizes with other membrane transport systems in specific membrane domains.

Research on β-lactam resistance in C. jeikeium has revealed sophisticated regulatory systems, such as those controlling Pbp2c expression, which is "under the control of a β-lactam-induced regulatory system encoded by two adjacent genes, jk0410 and jk0411" . Similar regulatory networks might coordinate the expression of CrcB1 with other transport systems in response to environmental stressors.

What strategies can overcome poor expression or solubility of recombinant CrcB1?

Membrane proteins like CrcB1 often present expression and solubility challenges. Consider these methodological interventions:

ChallengeIntervention StrategyRationale
Low expression levelsUse specialized expression strains (C41/C43, Lemo21)These strains are adapted for toxic or membrane protein expression
Reduce induction temperature to 16-20°CSlows expression rate, allowing proper membrane insertion
Optimize codon usage for expression hostImproves translation efficiency
Poor solubilityScreen multiple detergents (DDM, LMNG, CHAPS)Different detergents vary in their ability to extract and stabilize membrane proteins
Add stabilizing additives (glycerol, specific lipids)Mimics native membrane environment
Use fusion partners (MBP, SUMO)Enhances solubility while maintaining structure
Protein aggregationInclude reducing agents (DTT, β-mercaptoethanol)Prevents disulfide-mediated aggregation
Optimize purification buffer ionic strengthReduces non-specific interactions

When troubleshooting expression issues, implement a systematic approach, changing only one variable at a time and thoroughly documenting outcomes to identify optimal conditions.

How can researchers validate that recombinant CrcB1 maintains native conformation?

Ensuring that recombinant CrcB1 maintains its native conformation is critical for meaningful functional studies. Consider these validation approaches:

  • Circular dichroism (CD) spectroscopy: Assesses secondary structure elements and can verify proper folding compared to predicted structural characteristics.

  • Intrinsic tryptophan fluorescence: Changes in fluorescence emission spectra can indicate alterations in tertiary structure.

  • Limited proteolysis: Properly folded proteins exhibit characteristic proteolytic fragment patterns distinct from misfolded variants.

  • Thermal stability assays: Techniques like differential scanning fluorimetry (DSF) can assess protein stability and identify conditions that promote proper folding.

  • Functional validation: Ultimately, demonstration of expected functional activities (e.g., fluoride transport) provides the strongest evidence of native conformation.

For membrane proteins like CrcB1, additional consideration should be given to the lipid environment. Native-like lipid compositions in reconstitution experiments may be critical for proper folding and function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.