Recombinant Corynebacterium jeikeium Protein CrcB homolog 2 (crcB2)

Shipped with Ice Packs
In Stock

Description

Molecular and Genetic Characteristics

The crcB2 gene (locus tag: jk2059) is part of the C. jeikeium K411 genome, a multidrug-resistant clinical isolate . Key features include:

  • Gene location: Chromosomal, within a conserved genomic region.

  • Protein length: 170 amino acids (full-length) .

  • UniProt ID: Q4JSG6 .

  • Sequence: Contains transmembrane domains critical for its structural role .

Table 1: Genetic and protein features of crcB2

FeatureDetail
Gene namecrcB2
Locusjk2059
Protein length170 amino acids
Molecular functionChromosome condensation; putative role in stress adaptation
Conserved domainsTransmembrane helices, putative DNA-binding motifs

Recombinant Expression and Purification

The protein is produced via heterologous expression in Escherichia coli systems :

  • Expression vector: Modified pET-based plasmids with N-terminal His-tags .

  • Purification: Affinity chromatography (Ni-NTA) followed by size exclusion chromatography .

  • Purity: ≥85% as confirmed by SDS-PAGE .

Key steps in production:

  1. Cloning of crcB2 into an E. coli-compatible vector.

  2. Induction with IPTG at optimized temperatures (e.g., 16–37°C) .

  3. Solubilization using detergents for membrane protein extraction .

Biochemical Properties

  • Structural motifs: Predicted α-helical regions and hydrophobic patches indicative of membrane association .

  • Stability: Stable at -80°C for long-term storage; sensitive to repeated freeze-thaw cycles .

Research Applications

  • ELISA development: Used as an antigen for antibody production and immunoassays .

  • Functional studies: Investigating its role in chromosome organization under stress (e.g., antibiotic exposure) .

  • Comparative genomics: Analyzing homologs in multidrug-resistant Corynebacterium species .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we currently have in stock. However, if you have specific format requirements, please specify them when placing your order. We will prepare the product according to your request.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by multiple factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type will be established during production. If you have a preferred tag type, please communicate it to us, and we will prioritize development of the specified tag.
Synonyms
crcB2; jk2059; Putative fluoride ion transporter CrcB 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-170
Protein Length
full length protein
Species
Corynebacterium jeikeium (strain K411)
Target Names
crcB2
Target Protein Sequence
MNRLPPVALVFLGGALGAIIRWTLTVWIPALGDPTRVLGAATPLNIIGGIPLGDIALLVV NVLGALLLGLLVGMIPDSAHPRRTFWGTGVLGGFTSFSSLAAAVDATTDSASTILIGGTY GVFTLALGLIAAAMGLRLGRDLNELARLRRAADGADEPQDPHEPHKGGAR
Uniprot No.

Target Background

Function
Essential for reducing fluoride concentration within the cell, thereby mitigating its toxicity.
Database Links

KEGG: cjk:jk2059

STRING: 306537.jk2059

Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the genomic context of crcB2 in C. jeikeium K411?

The crcB2 gene (jk2059) is found in the C. jeikeium K411 genome, which consists of a circular chromosome of 2,462,499 bp and the circular bacteriocin-producing plasmid pKW4 (14,323 bp). The genome has a mean G+C content of 61.4%, and analysis of the complete genome sequence has identified the organization of various genes, including crcB2. Comparative genomic analysis shows that the C. jeikeium genome has undergone moderate reorganization of chromosomal architecture through various recombinational mechanisms, which may influence the genomic context of crcB2 .

How does the expression of recombinant CrcB2 differ from native expression in C. jeikeium?

When expressing recombinant CrcB2, researchers typically use expression systems like E. coli, which can produce the protein with different post-translational modifications compared to native expression in C. jeikeium. The protein is often expressed with affinity tags (such as His-tag) to facilitate purification. This differs from native expression where the protein is integrated into membrane structures in C. jeikeium. Expression levels are typically higher in recombinant systems, and special consideration must be given to proper folding of membrane proteins. For optimal expression in E. coli, protocols similar to those used for other C. jeikeium proteins may be adapted, including PCR amplification of the gene with appropriate primers, cloning into expression vectors, and transformation into competent cells .

What are the optimal conditions for recombinant expression and purification of CrcB2?

For optimal expression of recombinant CrcB2, researchers should consider:

  • Expression system: E. coli is commonly used for recombinant expression of C. jeikeium proteins.

  • Growth conditions: BHI media at 37°C under agitation (180 rpm) is suitable for many Corynebacterium proteins.

  • Induction: IPTG induction is typically used for expression under the control of promoters like trc (Ptrc).

  • Purification strategy: His-tagged proteins can be purified using nickel affinity chromatography.

  • Storage conditions: Store at -20°C/-80°C in Tris-based buffer with 50% glycerol.

  • Avoid repeated freeze-thawing: Aliquot and store working samples at 4°C for up to one week .

Membrane proteins like CrcB2 may require detergents during purification to maintain solubility and proper folding.

What methods are most effective for functional characterization of CrcB2 transport activity?

For functional characterization of CrcB2's putative fluoride transport activity, researchers should consider:

  • Liposome reconstitution assays: Reconstituting purified CrcB2 into liposomes and measuring ion flux using fluorescent probes or radioisotopes.

  • Whole-cell transport assays: Expressing CrcB2 in transport-deficient bacterial strains and measuring changes in ion accumulation.

  • Electrophysiological methods: Using patch-clamp techniques on reconstituted membranes or whole cells.

  • Fluoride sensitivity assays: Examining whether CrcB2 expression confers resistance to fluoride toxicity.

  • Mutation analysis: Creating point mutations in conserved residues to identify critical functional domains.

These approaches can be adapted from methods used to characterize other bacterial ion transporters, with modifications specific to the properties of CrcB2 .

What are the technical challenges when working with recombinant membrane proteins like CrcB2?

Working with recombinant membrane proteins presents several challenges:

  • Protein solubility: Membrane proteins often aggregate during expression and purification. Using appropriate detergents (like DDM, LDAO, or Tween-80) is crucial for maintaining solubility.

  • Proper folding: Ensuring correct folding is challenging; expression at lower temperatures (16-25°C) may improve folding.

  • Functional assays: Developing reliable assays to measure ion transport activity requires specialized techniques and equipment.

  • Structural stability: Membrane proteins can be unstable outside their native lipid environment; stabilizing agents may be necessary.

  • Expression yields: Yields are typically lower for membrane proteins; optimization of expression conditions is essential.

  • Protein orientation: Ensuring proper orientation when reconstituting into membranes for functional studies.

For C. jeikeium proteins specifically, researchers have successfully used Tween-80 supplementation in growth media to improve membrane protein handling .

What is the predicted membrane topology of CrcB2 and how does it relate to function?

Based on sequence analysis, CrcB2 is predicted to have multiple transmembrane segments with a topology typical of ion channel proteins. The transmembrane regions likely form a pore structure for facilitating fluoride ion transport across membranes. Key structural features include:

  • Transmembrane helices: Multiple hydrophobic regions that span the membrane.

  • Channel-forming motifs: Conserved residues that likely form the ion selectivity filter.

  • Cytoplasmic domains: Regions that may be involved in regulation or protein-protein interactions.

The topology can be experimentally verified using techniques such as cysteine accessibility scanning or epitope insertion coupled with immunofluorescence microscopy. Understanding this topology is crucial for mapping functional domains and designing site-directed mutagenesis experiments to probe structure-function relationships .

How does CrcB2 differ structurally and functionally from CrcB1 in C. jeikeium?

CrcB1 (UniProt ID: Q4JSG7) and CrcB2 (UniProt ID: Q4JSG6) in C. jeikeium share functional similarity as putative fluoride ion transporters but differ in several aspects:

FeatureCrcB1CrcB2
Length140 amino acids170 amino acids
Genomic locationjk2058jk2059
Sequence similarityReferenceModerate similarity to CrcB1
Predicted secondary structurePredominantly alpha-helicalAlpha-helical with potentially different arrangements
Expression patternMay be constitutively expressedMay be regulated differently

These differences suggest possible functional specialization, such as different ion affinities, regulatory mechanisms, or expression patterns under different environmental conditions. Determining the precise functional differences requires experimental characterization of both proteins .

What experimental approaches can be used to determine the crystal structure of CrcB2?

Determining the crystal structure of CrcB2 requires several advanced approaches:

  • Protein purification optimization:

    • Use detergent screening to identify optimal conditions for protein stability

    • Implement size-exclusion chromatography to ensure monodispersity

    • Consider fusion constructs to enhance solubility and crystallization

  • Crystallization strategies:

    • Lipidic cubic phase (LCP) crystallization for membrane proteins

    • Vapor diffusion methods with specialized membrane protein screens

    • Use of antibody fragments to stabilize flexible regions

  • Alternative structural methods:

    • Cryo-electron microscopy (Cryo-EM) for membrane proteins resistant to crystallization

    • NMR spectroscopy for dynamic regions of the protein

    • Small-angle X-ray scattering (SAXS) for low-resolution envelope determination

  • Structure validation:

    • Molecular dynamics simulations to assess structural stability

    • Mutagenesis studies to confirm functional sites

    • Comparative modeling with related structures

These approaches have been successfully applied to other membrane transporters and could be adapted for CrcB2 structural studies .

What is the role of CrcB2 in C. jeikeium pathogenicity and antibiotic resistance?

While the direct role of CrcB2 in C. jeikeium pathogenicity remains to be fully elucidated, several inferences can be made:

  • Ion homeostasis: As a putative fluoride transporter, CrcB2 likely contributes to maintaining ion balance in C. jeikeium, which is essential for survival in host environments.

  • Stress response: Fluoride resistance may be important during host immune responses or exposure to antimicrobial agents.

  • Potential connection to antibiotic resistance: C. jeikeium exhibits high levels of antimicrobial resistance, particularly to β-lactams. The pbp2c gene confers β-lactam resistance and is present in resistant strains but absent in sensitive strains. While no direct link between CrcB2 and pbp2c has been established, membrane proteins often interact with resistance mechanisms .

  • Clinical significance: C. jeikeium is an opportunistic pathogen in immunocompromised patients, particularly those with hematologic malignancies. The bacterium has a 70-71% rate of true bacteremia with high mortality rates (30-34%). Understanding all membrane proteins, including CrcB2, may provide insights into its pathogenicity mechanisms .

How can CrcB2 be targeted for potential therapeutic interventions against C. jeikeium infections?

Targeting CrcB2 for therapeutic interventions could involve several strategies:

  • Small molecule inhibitors: Developing compounds that specifically block the ion transport function of CrcB2, potentially disrupting cellular homeostasis.

  • Peptide-based inhibitors: Designing peptides that mimic interacting partners or critical regions of CrcB2 to interfere with its function.

  • Combination therapies: Using CrcB2 inhibitors alongside conventional antibiotics to enhance efficacy against resistant strains.

  • Immunological approaches: Developing antibodies or vaccines targeting exposed epitopes of CrcB2 on the bacterial surface.

  • CRISPR-Cas systems: Utilizing CRISPR-based antimicrobials to specifically target the crcB2 gene.

The development of such interventions would require thorough understanding of CrcB2 structure-function relationships and validation in appropriate experimental models. Special consideration should be given to the multidrug-resistant nature of C. jeikeium infections, which are often only susceptible to glycopeptides like vancomycin .

How does dormancy in C. jeikeium affect the expression and function of membrane proteins like CrcB2?

C. jeikeium can form dormant "non-culturable" (NC) cells in stationary phase upon gradual acidification of the growth medium. This dormancy state significantly impacts membrane protein expression and function:

  • Metabolic activity: Dormant C. jeikeium cells show less than 1% of the RNA synthesis activity compared to cells grown under neutral pH, suggesting dramatic changes in protein expression patterns, including membrane proteins like CrcB2 .

  • Morphological changes: C. jeikeium undergoes morphological changes from bacilli to coccoid forms during dormancy, which likely affects membrane architecture and the functioning of membrane proteins .

  • Resuscitation requirements: Dormant cells require specific conditions for resuscitation, including supernatants from actively growing cultures. These conditions may trigger reactivation of membrane protein expression and function .

  • Potential adaptation mechanism: The expression of membrane transporters like CrcB2 may be differentially regulated during dormancy as part of an adaptive response to stress conditions.

Understanding how CrcB2 expression and function change during dormancy could provide insights into persistent infections and the development of strategies to target dormant C. jeikeium cells .

How conserved is CrcB2 across different Corynebacterium species and what does this suggest about its evolutionary importance?

Analysis of CrcB2 across Corynebacterium species reveals:

  • Sequence conservation: Moderate to high sequence conservation exists among CrcB homologs across Corynebacterium species, suggesting functional importance.

  • Genomic context: The genomic location and organization of crcB genes show variations across species, indicating potential species-specific adaptations.

  • Species distribution:

    • Pathogenic species like C. jeikeium, C. urealyticum, and C. striatum contain CrcB homologs

    • Non-pathogenic species may show different patterns of conservation

  • Evolutionary implications: The conservation of CrcB proteins suggests selective pressure to maintain fluoride transport function, possibly related to environmental adaptation or pathogenicity mechanisms.

Comparative genomic analysis of C. jeikeium with C. glutamicum, C. efficiens, and C. diphtheriae has identified both conserved chromosomal backbones and species-specific genes. CrcB2 conservation patterns within this context can provide insights into its evolutionary significance .

What experimental approaches can determine if CrcB2 interacts with other membrane proteins or cellular components in C. jeikeium?

To investigate protein-protein interactions involving CrcB2, researchers can employ:

  • Co-immunoprecipitation (Co-IP): Using antibodies against CrcB2 to pull down the protein along with interacting partners, followed by mass spectrometry identification.

  • Bacterial two-hybrid systems: Modified for membrane proteins to detect interactions between CrcB2 and other proteins.

  • Cross-linking coupled with mass spectrometry: Chemical cross-linking to capture transient interactions followed by mass spectrometry identification.

  • Fluorescence resonance energy transfer (FRET): Tagging CrcB2 and potential interacting partners with fluorescent proteins to detect proximity in vivo.

  • Split-GFP complementation: Fusing fragments of GFP to CrcB2 and potential partners to visualize interactions through reconstituted fluorescence.

  • Protein-lipid overlay assays: To determine if CrcB2 interacts with specific membrane lipids.

  • Surface plasmon resonance (SPR): For quantitative measurement of binding affinities between purified CrcB2 and potential interacting molecules.

These approaches would need to be optimized for the specific properties of CrcB2 and the challenges of working with membrane proteins .

How can recombinant CrcB2 be employed in high-throughput screening for novel antimicrobial compounds?

Recombinant CrcB2 can be utilized in high-throughput screening through:

  • Fluorescence-based transport assays:

    • Reconstituting CrcB2 in liposomes loaded with fluoride-sensitive fluorescent probes

    • Monitoring changes in fluorescence in response to compound treatment

    • Automating for 96 or 384-well plate formats

  • Cell-based screening platforms:

    • Expressing CrcB2 in reporter bacterial strains

    • Using growth inhibition or fluorescent reporters as readouts

    • Screening compound libraries for specific inhibition

  • Binding assays:

    • Developing thermal shift assays to identify compounds that bind to purified CrcB2

    • Surface plasmon resonance to quantify binding affinities

    • Fragment-based screening approaches

  • In silico screening followed by validation:

    • Structure-based virtual screening if a model of CrcB2 can be developed

    • Molecular docking studies with compound libraries

    • Experimental validation of computational hits

  • Data analysis approaches:

    • Machine learning algorithms to identify patterns in successful inhibitors

    • Structure-activity relationship analysis for hit optimization

This approach could yield novel compounds with activity against multidrug-resistant C. jeikeium, which currently shows resistance to most antibiotics except glycopeptides like vancomycin .

What are the critical controls needed when studying CrcB2 function in heterologous expression systems?

When studying CrcB2 function in heterologous systems, researchers should implement these critical controls:

  • Expression verification controls:

    • Western blotting to confirm proper expression and expected molecular weight

    • Fluorescence microscopy for tagged proteins to verify membrane localization

    • RT-qPCR to quantify transcript levels

  • Functional controls:

    • Empty vector controls to establish baseline activity

    • Known ion transporters as positive controls

    • Inactive mutants of CrcB2 (e.g., with mutations in conserved residues)

  • System-specific controls:

    • Host strain without endogenous CrcB homologs to prevent interference

    • Measurement of host cell viability to ensure observed effects are not due to toxicity

    • Controlled expression levels to prevent artifacts from overexpression

  • Specificity controls:

    • Testing multiple ions to confirm specificity for fluoride

    • Competitive inhibition assays

    • Dose-response relationships to establish pharmacological profiles

  • Environmental controls:

    • Consistent pH, temperature, and buffer conditions

    • Controlled membrane composition in reconstitution experiments

    • Time-course measurements to capture dynamics

These controls ensure that observed effects are specifically attributable to CrcB2 function rather than artifacts of the expression system .

How can CRISPR-Cas9 technology be applied to study CrcB2 function in C. jeikeium?

CRISPR-Cas9 technology can be applied to study CrcB2 function through:

  • Gene knockout strategies:

    • Designing guide RNAs targeting the crcB2 gene

    • Using non-homologous end joining (NHEJ) or homology-directed repair (HDR) for gene disruption

    • Creating clean deletions to avoid polar effects on adjacent genes

  • Gene editing approaches:

    • Introducing point mutations to study structure-function relationships

    • Creating tagged versions of CrcB2 for localization and interaction studies

    • Engineering regulatable promoters to control expression levels

  • CRISPRi for gene silencing:

    • Using catalytically inactive Cas9 (dCas9) fused to repressors

    • Targeting the crcB2 promoter region for transcriptional repression

    • Creating conditional knockdowns to study essential functions

  • CRISPRa for gene activation:

    • Using dCas9 fused to activators to upregulate CrcB2 expression

    • Studying effects of overexpression on cell physiology and stress responses

  • CRISPR screening:

    • Creating genome-wide CRISPR libraries to identify genes interacting with crcB2

    • Screening for synthetic lethality or suppressor mutations

    • Identifying regulatory networks controlling CrcB2 expression

For C. jeikeium specifically, CRISPR-based methods would need to be optimized for its particular genetic characteristics and transformation efficiency. The approach has been successful with other Corynebacterium species and could yield valuable insights into CrcB2 function and its role in C. jeikeium biology .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.