Recombinant Corynebacterium jeikeium Undecaprenyl-diphosphatase 2 (uppP2)

Shipped with Ice Packs
In Stock

Description

Functional Role in Peptidoglycan Biosynthesis

uppP2 catalyzes the hydrolysis of undecaprenyl pyrophosphate (UPP) to undecaprenyl phosphate (UP), a lipid carrier essential for peptidoglycan and teichoic acid biosynthesis . This recycling process is critical for bacterial cell wall integrity and is targeted by bacitracin, an antibiotic that binds UPP to block regeneration . Key functional insights:

  • Antibiotic Resistance: uppP2 overexpression in C. jeikeium contributes to bacitracin resistance by maintaining UP availability despite drug pressure .

  • Genomic Context: The uppP2 gene (jk0957) is chromosomally encoded in C. jeikeium K411, a multidrug-resistant clinical isolate .

Research Applications

Recombinant uppP2 is primarily utilized in:

  • Mechanistic Studies: Elucidating bacitracin resistance mechanisms in nosocomial pathogens .

  • Drug Discovery: Screening inhibitors targeting lipid carrier recycling in Gram-positive bacteria .

  • Diagnostic Tools: Serving as an antigen in ELISA kits for antibody detection .

Future Directions

Current research gaps include:

  • Structural studies to resolve uppP2’s catalytic mechanism.

  • In vivo validation of uppP2 as a therapeutic target in multidrug-resistant C. jeikeium infections.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you require a specific tag type, please inform us, and we will prioritize its development if feasible.
Synonyms
uppP2; jk0957; Undecaprenyl-diphosphatase 2; Bacitracin resistance protein 2; Undecaprenyl pyrophosphate phosphatase 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-290
Protein Length
full length protein
Species
Corynebacterium jeikeium (strain K411)
Target Names
uppP2
Target Protein Sequence
MTTDMTWAQTIILSLIQGLTEFLPVSSSGHLRIFSTLLWGEDAGASFTAVIQLGTELAVL VFFAKDIWNIASAWCKGVWEWLTDLTGKHGRRVHRQSFDYRMGWMVIVGTLPVAVLGYLG KDLIRDNLRNLWITATMLVLFSFVFILAERMGRRERSFDELTMRDSVIMGFAQCLALIPG VSRSGGTVSAGLFLNLDREVATRYSFLLAIPAVLASGLFSLPDAFSPDAGQAASGAQLFV GTAIAFAVGYASIAWLLKFVANHSFAWFALWRIPLGLAVMGLLAFGVLQA
Uniprot No.

Target Background

Function
Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP). Confers resistance to bacitracin.
Database Links

KEGG: cjk:jk0957

STRING: 306537.jk0957

Protein Families
UppP family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Undecaprenyl-diphosphatase 2 (uppP2) and what is its role in Corynebacterium jeikeium?

Undecaprenyl-diphosphatase 2 (uppP2) in Corynebacterium jeikeium is an enzyme also known as Bacitracin resistance protein 2 or Undecaprenyl pyrophosphate phosphatase 2. It plays a crucial role in cell wall biosynthesis by recycling the lipid carrier undecaprenyl pyrophosphate (UPP) to undecaprenyl phosphate (UP). This reaction is essential for the lipid II cycle that shuttles cell wall building blocks during peptidoglycan and wall teichoic acid synthesis . Based on studies of related UPP phosphatases, uppP2 likely connects cell wall homeostasis to the envelope stress response, similar to how UppP functions in Bacillus subtilis .

What experimental conditions are optimal for working with recombinant uppP2?

When working with recombinant Corynebacterium jeikeium uppP2, the following experimental conditions should be considered:

  • Storage conditions: Store at -20°C/-80°C upon receipt, with aliquoting necessary for multiple use to avoid repeated freeze-thaw cycles. The shelf life in liquid form is approximately 6 months at -20°C/-80°C, while the lyophilized form can last up to 12 months at the same temperatures .

  • Buffer conditions: The protein is typically provided in Tris/PBS-based buffer with 6% Trehalose at pH 8.0, which helps maintain stability .

  • Expression system: For recombinant production, an in vitro E. coli expression system is commonly used, often with an N-terminal 10xHis-tag to facilitate purification .

Following proper experimental design principles is critical when working with this enzyme, including clearly defining the research question, formulating a testable hypothesis, controlling variables, and planning for appropriate data collection and analysis .

How does uppP2 contribute to antibiotic resistance in Corynebacterium jeikeium?

Corynebacterium jeikeium is often associated with multidrug-resistant nosocomial infections in immunocompromised patients . As an Undecaprenyl pyrophosphate phosphatase (also called Bacitracin resistance protein 2), uppP2 likely contributes to antibiotic resistance through multiple mechanisms:

  • Direct bacitracin resistance: Bacitracin targets the lipid II cycle by binding to UPP, preventing its recycling. UPP phosphatases like uppP2 can counteract this by increasing the rate of UPP dephosphorylation, thereby maintaining sufficient UP levels for cell wall synthesis even in the presence of bacitracin .

  • Cell wall homeostasis maintenance: By ensuring proper recycling of the lipid carrier, uppP2 helps maintain cell wall integrity even under antibiotic stress. This is similar to how BcrC functions in Bacillus subtilis during cell envelope stress response .

  • Bottleneck prevention: The lipid II cycle represents a bottleneck in cell wall synthesis, with only approximately 2×10⁵ UP molecules present per cell. Antibiotics target this bottleneck, as blocking any step leads to accumulation of intermediates and shortage of free carrier molecules. UPP phosphatases like uppP2 help prevent this bottleneck, particularly under stress conditions .

What methodological approaches can be used to study the enzymatic activity of uppP2?

To study the enzymatic activity of Recombinant Corynebacterium jeikeium uppP2, researchers can employ several methodological approaches:

  • In vitro phosphatase assays: Using purified recombinant uppP2 with N-terminal 10xHis-tag , researchers can measure the dephosphorylation of UPP to UP using colorimetric assays that detect released inorganic phosphate.

  • Reconstitution in artificial membranes: Since uppP2 is a membrane protein, its activity can be studied in proteoliposomes or planar lipid bilayers to better mimic its native environment.

  • Complementation studies: The gene can be expressed in a UPP phosphatase-deficient strain (similar to the approach described for jk0268 in Corynebacterium glutamicum ) to assess functional complementation.

  • Depletion studies: Following the experimental design principles outlined in search result , researchers can create depletion strains where uppP2 expression is under a controllable promoter to study the effects of reduced enzyme levels on cell morphology, growth, and antibiotic resistance.

The experimental design should include:

Experimental ComponentDescription
Independent VariableuppP2 expression level or activity (e.g., wild type vs. depleted)
Dependent VariablesGrowth rate, cell morphology, antibiotic MICs, UPP/UP ratio
ControlsWild-type strain, strain with empty vector, inactive uppP2 mutant
ReplicatesMinimum of three biological replicates with three technical replicates each
MeasurementsOptical density for growth, microscopy for morphology, HPLC for UPP/UP levels

How does uppP2 from Corynebacterium jeikeium compare to UPP phosphatases from other bacterial species?

Comparing uppP2 from Corynebacterium jeikeium to UPP phosphatases from other bacteria reveals important evolutionary and functional relationships:

  • Functional similarity to B. subtilis UPP phosphatases: The functions of uppP2 likely parallel those of BcrC and UppP in Bacillus subtilis, which together form an essential physiological function. In B. subtilis, these enzymes show some functional redundancy but also distinct roles: UppP is crucial for sporulation, while BcrC is more important during growth and in defense against cell envelope stress .

  • Sequence homology: While the search results don't provide direct sequence comparisons, UPP phosphatases typically fall into different families. Protein sequence analysis could reveal whether uppP2 belongs to the same family as BcrC (which is typically a member of the PAP2 family) or UppP (which belongs to the bacitracin resistance protein family).

  • Physiological impact of depletion: Studies with B. subtilis show that UPP phosphatase depletion leads to severe morphological changes during exponential growth, including bulging cells, indicative of compromised cell wall synthesis. Similar phenotypes might be expected for uppP2 depletion in C. jeikeium .

What are the key steps in designing experiments to study uppP2 function?

When designing experiments to study Recombinant Corynebacterium jeikeium uppP2 function, researchers should follow these key steps:

How can researchers effectively control variables when studying uppP2 in cell wall biosynthesis?

Controlling variables is critical when studying uppP2's role in cell wall biosynthesis due to the complexity of bacterial cell wall synthesis pathways. Researchers should implement the following controls:

  • Growth conditions standardization:

    • Use defined media with consistent composition

    • Maintain precise temperature, pH, and aeration

    • Standardize growth phase for all experiments (e.g., mid-exponential phase)

    • Control cell density across experiments

  • Genetic background control:

    • Use isogenic strains differing only in uppP2 expression

    • Consider complementation studies to verify phenotypes are specifically due to uppP2

    • Control for potential polar effects on neighboring genes

  • Expression level control:

    • Use inducible promoters with titratable expression

    • Verify expression levels via qRT-PCR or Western blotting

    • Include strains with known expression levels as references

  • Functional redundancy control:

    • Consider simultaneous monitoring of other UPP phosphatases in C. jeikeium

    • Assess potential compensatory mechanisms when uppP2 is depleted

    • Design experiments that account for the synthetic lethality observed with UPP phosphatases in B. subtilis

The following table outlines a comprehensive approach to variable control:

Variable TypeControl MethodMeasurement Technique
GeneticIsogenic strainsWhole genome sequencing
ExpressionInducible promotersqRT-PCR, Western blot
GrowthStandardized conditionsOD600, viable count
Enzymatic activityIn vitro assaysPhosphate release assay
Cell wall integrityCell wall stressReporter gene assays

What analytical methods are most appropriate for assessing uppP2 activity and its impact on cell physiology?

To comprehensively assess uppP2 activity and its impact on cell physiology, researchers should employ multiple analytical methods:

  • Biochemical assays:

    • Phosphatase activity assays using purified recombinant uppP2

    • Lipid extraction and analysis to quantify UPP/UP ratios

    • Mass spectrometry to identify reaction products and intermediates

  • Microscopy techniques:

    • Phase contrast microscopy to observe cell morphology changes

    • Fluorescence microscopy with cell wall-specific dyes

    • Electron microscopy to analyze cell wall ultrastructure

    • Live cell imaging to track dynamic changes during growth and division

  • Physiological measurements:

    • Growth curve analysis under various stress conditions

    • Minimum inhibitory concentration (MIC) determination for cell wall-targeting antibiotics

    • Cell envelope integrity assays (e.g., susceptibility to osmotic stress)

  • Molecular and genetic approaches:

    • Transcriptomics to identify genes affected by uppP2 depletion

    • Protein interaction studies to identify partners of uppP2

    • Suppressor screens to identify genes that can compensate for uppP2 deficiency

  • Computational methods:

    • Molecular modeling of uppP2 structure and substrate binding

    • Systems biology approaches to model cell wall homeostasis networks

    • Comparative genomics to understand evolutionary conservation

Based on results from B. subtilis studies, researchers should particularly focus on growth phase-dependent effects, as UPP phosphatase depletion causes more severe phenotypes during exponential growth compared to stationary phase .

How should researchers interpret contradictory results when studying uppP2 function?

When encountering contradictory results in uppP2 research, scientists should employ a systematic approach to reconcile discrepancies:

  • Experimental condition variations: First, examine differences in experimental conditions that might explain contradictory results. For UPP phosphatases, growth phase has been shown to significantly affect phenotypes, with more pronounced effects during exponential growth . Consider creating a comparison table:

Experimental FactorStudy AStudy BPotential Impact
Growth phaseExponentialStationaryUPP phosphatase depletion causes severe morphological changes only during exponential growth
Media compositionRichMinimalNutrient availability affects cell wall synthesis demands
Temperature37°C30°CEnzyme activity and membrane fluidity differ with temperature
Strain backgroundLab strainClinical isolateGenetic differences may affect redundancy and compensation
  • Functional redundancy assessment: Contradictory results might stem from the presence of multiple UPP phosphatases with overlapping functions. In B. subtilis, BcrC and UppP form a synthetic lethal gene pair, meaning either alone can support growth, but losing both is lethal . Similar redundancy might exist in C. jeikeium, requiring careful genetic analysis.

  • Technical approach differences: Different methods for measuring the same parameter can yield varying results. For example, in vitro phosphatase activity might not directly correlate with in vivo function due to membrane environment effects or interaction partners present only in vivo.

  • Statistical robustness evaluation: Reassess the statistical significance of contradictory findings, considering sample sizes, variability, and appropriate statistical tests.

  • Contextual interpretation: Some contradictions may reflect genuine biological complexity rather than experimental error. For instance, uppP2 might have different roles under different stress conditions or growth phases.

What statistical approaches are most appropriate for analyzing uppP2 experimental data?

When analyzing experimental data related to Recombinant Corynebacterium jeikeium uppP2, researchers should employ these statistical approaches:

  • For enzymatic activity data:

    • Michaelis-Menten kinetics analysis to determine Km and Vmax parameters

    • Regression analysis to establish enzyme reaction rates under different conditions

    • Analysis of variance (ANOVA) to compare activity across multiple experimental conditions

  • For growth and morphology studies:

    • Growth curve analysis using nonlinear regression to determine growth rates

    • Cell size distribution analysis using appropriate distribution models

    • Multivariate analysis for correlating morphological parameters with uppP2 expression levels

  • For antibiotic susceptibility testing:

    • Determination of minimum inhibitory concentrations (MICs) with appropriate confidence intervals

    • Dose-response curve analysis to assess the relationship between uppP2 expression and antibiotic resistance

    • Time-kill kinetics to evaluate the dynamics of bacterial response to antibiotics

  • For gene expression studies:

    • qRT-PCR data analysis using the ΔΔCt method with appropriate reference genes

    • Statistical analysis of RNA-seq data with tools designed for differential expression analysis

  • For replication and reproducibility:

    • Power analysis to determine appropriate sample sizes

    • Meta-analysis approaches when combining data from multiple experiments

    • Bayesian statistical methods to incorporate prior knowledge into the analysis

The experimental design should follow established guidelines , with clear identification of variables, multiple trials to ensure reproducibility, and appropriate controls to account for confounding factors.

How can researchers effectively compare their uppP2 findings with results from studies on related enzymes?

To effectively compare findings on Corynebacterium jeikeium uppP2 with studies on related enzymes, researchers should:

  • Standardize comparison parameters:

    • Develop a standardized set of assays and conditions for comparing enzymatic activities

    • Establish common metrics for phenotypic outcomes (e.g., standardized measures of cell morphology or antibiotic resistance)

    • Use recombinant proteins with similar tags and purification methods to minimize technical variables

  • Create comprehensive comparison tables:

    • Generate tables comparing key properties across different UPP phosphatases

    • Include information on sequence identity, substrate specificity, kinetic parameters, and physiological roles

Example comparison table:

PropertyC. jeikeium uppP2B. subtilis UppPB. subtilis BcrCOther UPP phosphatases
Protein length290 aa [data][data][data]
Catalytic efficiency[data][data][data][data]
Role in sporulation[data]Essential Not essential [data]
Response to stress[data]Not upregulated Upregulated [data]
Morphological impact when depleted[data]Severe during growth Less severe [data]

By systematically comparing uppP2 with related enzymes like UppP and BcrC from B. subtilis , researchers can better understand both the conserved and unique aspects of uppP2 function in C. jeikeium.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.