Recombinant Corynebacterium kroppenstedtii Sec-independent protein translocase protein TatC (tatC)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Corynebacterium kroppenstedtii TatC

The twin-arginine translocation (Tat) system is a conserved protein secretion pathway that transports fully folded proteins across cellular membranes, a process distinct from the Sec system. In Corynebacterium kroppenstedtii, a Gram-positive bacterium implicated in human mastitis, the TatC protein serves as a core component of this pathway. Recombinant C. kroppenstedtii TatC is a engineered version of this protein, produced via heterologous expression in E. coli for research or therapeutic applications. Below is a detailed analysis of its molecular structure, functional role, and experimental insights.

Primary Structure

Recombinant TatC from C. kroppenstedtii (strain DSM 44385, CCµg 35717) is a 414-amino acid protein with a calculated molecular weight of ~45 kDa. Key features include:

  • Sequence Motifs: The N-terminal region contains a transmembrane domain critical for membrane integration, while the C-terminal region includes conserved residues (e.g., Gln/Glu motifs) essential for substrate recognition and TatA interaction .

  • Post-Translational Modifications: The recombinant protein is typically His-tagged for purification and structural studies .

PropertyValue
Length414 amino acids
Molecular Weight~45 kDa
UniProt IDC4LIK6
Expression HostE. coli
TagN-terminal His-tag (unless specified otherwise)
Storage BufferTris-based buffer with 50% glycerol

Tertiary Structure

While structural data for C. kroppenstedtii TatC is limited, homology with Aquifex aeolicus TatC reveals a six-transmembrane helix (TM1–TM6) architecture. TM1–TM2 and TM5–TM6 form a structural scaffold, with a periplasmic cap stabilizing the helical arrangement . Functional studies in related species (e.g., C. glutamicum) suggest TatC binds substrates via conserved surface residues and recruits TatA/B for translocation .

Role in the Tat Pathway

In Corynebacterium spp., the Tat system minimally requires TatA and TatC for secretion, with TatB enhancing efficiency . Key findings from C. glutamicum include:

  • TatC as a Bottleneck: Overexpression of TatC increases secretion yields by ~3x, indicating its limiting role in substrate recognition and membrane channel formation .

  • TatB Dependency: Unlike in Gram-negative bacteria, Corynebacterium TatB is dispensable but improves secretion rates .

Substrate Specificity

TatC recognizes twin-arginine (RR) motifs in signal peptides. In C. kroppenstedtii, potential substrates may include:

  • Enzymes: Proteases or transglutaminases, as seen in C. glutamicum .

  • Virulence Factors: Hypothetical roles in mastitis pathogenesis, though direct evidence is lacking .

Expression and Purification

Recombinant C. kroppenstedtii TatC is produced in E. coli using plasmids like pVC7, with purification via metal affinity chromatography (His-tag) .

Key Steps:

  1. Cloning: PCR amplification of tatC from genomic DNA.

  2. Expression: Induction with IPTG in E. coli.

  3. Purification: Ni-NTA affinity chromatography.

Research Applications

  • Structural Studies: Cryo-EM or X-ray crystallography to resolve substrate-binding mechanisms .

  • Functional Assays: Co-expression with TatA/B to test translocation efficiency of recombinant substrates .

Knowledge Gaps

  • Structural Data: No high-resolution structures of C. kroppenstedtii TatC exist; reliance on homology models from A. aeolicus.

  • Substrate Profile: Limited information on endogenous Tat-dependent proteins in C. kroppenstedtii.

Potential Applications

  • Biotechnology: Engineered Tat systems for high-yield secretion of therapeutic proteins in Corynebacterium .

  • Pathogenesis Research: Investigating TatC’s role in mastitis through gene knockout studies .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, kindly indicate them when placing your order. We will prepare the product according to your specifications.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
tatC; ckrop_0907; Sec-independent protein translocase protein TatC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-414
Protein Length
full length protein
Species
Corynebacterium kroppenstedtii (strain DSM 44385 / JCM 11950 / CIP 105744 / CCUG 35717)
Target Names
tatC
Target Protein Sequence
MTQSTSVSKGGRVSRKAKKNPDGTMSIVDHLRELRTRLLRALAAIAVTTIIGFIWYEHGI PAWAIGPLHVPRLPSLGEILKEPYCSLPPSARATFSADNECRLLATSPFEMFMLRMKMGG LAGLVMACPIWLIEIWRFITPGLLKNERRWTLSVGTIAGFLFVLGVVAAYLVLPMGLDVL LHLGDSTQISALTGEKYFNFVIALILVFGLSFEVPLFTAMLNLAGVVHYEQLKDKRRIMI VVIFIFAAIATPGQDPISMLVLALTLVVLMELALQFTRIHDRRAARHVSEWEGLSDDEAS PLKVAPSSIPAAESIYDGDHKGIAGGGDAHPAGGSGPIPKPSPVTAPTRAPSASESPTPT PSPAPSDSPTSGSHHAPPAAVLRRGPRSWNDSTGDNDGKPGQDTIQSSSFDDVL
Uniprot No.

Target Background

Function
This protein is part of the twin-arginine translocation (Tat) system, which transports large folded proteins across membranes. These proteins contain a characteristic twin-arginine motif in their signal peptide. Working in conjunction with TatB, TatC acts as a receptor directly interacting with Tat signal peptides.
Database Links
Protein Families
TatC family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.