Recombinant Corynebacterium urealyticum ATP synthase subunit b (atpF)

What is Recombinant Corynebacterium urealyticum ATP synthase subunit b (atpF)?

Recombinant Corynebacterium urealyticum ATP synthase subunit b is a laboratory-produced protein that replicates the native ATP synthase subunit b found in C. urealyticum (strain ATCC 43042 / DSM 7109) . This protein is encoded by the atpF gene (locus cu0712) and contains 186 amino acids in its full-length form . It functions as a critical component of the F-type ATP synthase complex, specifically within the F₀ sector that forms the membrane-embedded proton channel . The recombinant version is produced through heterologous expression systems to provide researchers with purified protein for structural, functional, and biochemical studies. ATP synthase subunit b serves as a peripheral stalk that connects the F₁ and F₀ sectors of the ATP synthase complex, playing a crucial role in maintaining the structural integrity of the complex during rotational catalysis .

How is the purity and identity of Recombinant C. urealyticum ATP synthase subunit b verified?

Verification of the purity and identity of Recombinant C. urealyticum ATP synthase subunit b involves a multi-step analytical process:

• SDS-PAGE Analysis: The protein should appear as a single band at approximately 20 kDa, corresponding to the expected molecular weight based on its 186 amino acid sequence.

• Western Blot: Using antibodies specific to the affinity tag (if present) or to the ATP synthase subunit b protein directly.

• Mass Spectrometry:

  • Peptide mass fingerprinting following trypsin digestion

  • Liquid chromatography-tandem mass spectrometry (LC-MS/MS) to confirm sequence identity

• Protein Sequencing: N-terminal sequencing to confirm the start of the protein matches the expected sequence: MTNTFFLAAETLPLEEPINPLIPPLYDIVWSI .

• Functional Assays: Reconstitution with other ATP synthase components to verify ability to form functional complexes.

The combination of these methods provides comprehensive verification of both purity and identity, with MS-based techniques offering the highest confidence for sequence confirmation.

What expression systems are typically used for Recombinant C. urealyticum ATP synthase subunit b production?

Production of Recombinant C. urealyticum ATP synthase subunit b typically employs the following expression systems, each with distinct advantages depending on research requirements:

For optimal expression in E. coli systems, the atpF gene is typically codon-optimized and cloned into vectors containing T7 or tac promoters. Induction conditions must be carefully optimized, with expression typically conducted at lower temperatures (16-25°C) to enhance proper folding of the membrane-associated protein. Purification commonly employs affinity chromatography via an N- or C-terminal tag, followed by size exclusion chromatography to ensure homogeneity .

How does C. urealyticum ATP synthase subunit b compare structurally to homologs in other bacterial species?

C. urealyticum ATP synthase subunit b shares structural characteristics with homologs in other bacterial species while demonstrating species-specific variations:

What storage and handling conditions are optimal for maintaining C. urealyticum ATP synthase subunit b activity?

Optimal storage and handling of Recombinant C. urealyticum ATP synthase subunit b requires careful attention to buffer composition, temperature, and physical handling to maintain structural integrity and functional activity:

• Storage Buffer Composition:

  • Tris-based buffer (typically 20-50 mM, pH 7.5-8.0)

  • 50% glycerol as a cryoprotectant

  • Often supplemented with reducing agents (1-5 mM DTT or 2-mercaptoethanol) to prevent oxidation of cysteine residues

  • Salt concentration of 100-200 mM NaCl to maintain solubility

• Temperature Conditions:

  • Long-term storage at -20°C or -80°C

  • Working aliquots maintained at 4°C for up to one week

  • Avoid repeated freeze-thaw cycles that can lead to protein denaturation

• Handling Considerations:

  • Minimize exposure to room temperature

  • Avoid vigorous vortexing that can cause protein denaturation

  • Use low-protein-binding tubes and pipette tips

  • Filter sterilize rather than autoclave solutions containing the protein

• Stability Assessment:

  • Regular verification of protein integrity by SDS-PAGE

  • Functional assays to confirm retained biological activity

  • Thermal shift assays (DSF) to monitor stability under varying conditions

Maintaining these conditions ensures the highest quality protein for downstream experimental applications.

How can C. urealyticum ATP synthase subunit b be integrated into artificial membrane systems for bioenergetic studies?

Integration of C. urealyticum ATP synthase subunit b into artificial membrane systems requires a methodical approach addressing both the reconstitution of the complete ATP synthase complex and the creation of functional artificial membrane environments:

• Reconstitution Strategies:

  • Co-reconstitution method: Purified C. urealyticum ATP synthase subunit b must be combined with other subunits of the ATP synthase complex (α, β, γ, δ, ε, a, and c) in the correct stoichiometry before membrane incorporation.

  • Sequential incorporation: The F₀ sector (containing subunits a, b, and c) is first reconstituted into membranes, followed by addition of the F₁ sector (α, β, γ, δ, and ε).

• Artificial Membrane Systems:

  • Liposomes: Spherical vesicles composed of phospholipids (typically POPC, POPE, and POPG mixtures) with diameters of 100-200 nm.

  • Proteoliposomes (PLs): Liposomes containing integrated ATP synthase complexes that can be used to measure ATP synthesis driven by artificially imposed proton gradients.

  • Giant Unilamellar Vesicles (GUVs): Larger vesicles (1-100 μm) that can encapsulate additional components for more complex functional studies .

• Proton Gradient Generation Methods:

  • Light-driven systems: Incorporation of bacteriorhodopsin (bR) alongside ATP synthase creates a system where light energy drives proton pumping and subsequent ATP synthesis. Optimal ratios of approximately 3500 bR molecules per 18 ATP synthase complexes have been reported to achieve maximal ATP synthesis rates of 8.3 ± 0.3 s⁻¹ .

  • Chemical gradients: Acid-base transitions or K⁺/valinomycin systems can establish temporary proton gradients.

• Functional Assessment:

  • ATP synthesis measurement: Luciferin-luciferase assays can detect ATP production upon energization.

  • Proton translocation: pH-sensitive fluorescent dyes monitor internal pH changes.

  • Membrane potential: Voltage-sensitive dyes assess the electrical component of the proton motive force.

When optimized, these systems have demonstrated the ability to produce approximately 0.6 × 10⁶ ATP molecules per proteoliposome within 4 hours of illumination in light-driven systems .

What approaches can be used to investigate the interaction between C. urealyticum ATP synthase subunit b and other components of the ATP synthase complex?

Investigating interactions between C. urealyticum ATP synthase subunit b and other components of the ATP synthase complex requires sophisticated techniques spanning structural, biochemical, and computational approaches:

• Crosslinking Mass Spectrometry (XL-MS):

  • Chemical crosslinkers (like BS³ or EDC) stabilize protein-protein interactions

  • Crosslinked complexes are digested and analyzed by MS to identify interaction sites

  • Data analysis identifies distance constraints between specific residues

  • This approach can map interactions of subunit b with δ, a, and F₁ components

• Surface Plasmon Resonance (SPR) and Bio-Layer Interferometry (BLI):

  • Quantitative measurement of binding kinetics (kon, koff) and affinity (KD)

  • Real-time analysis of complex formation

  • Comparison of wild-type interactions versus mutant variants

  • Experimental setup typically immobilizes subunit b and measures binding of other subunits

• Fluorescence Resonance Energy Transfer (FRET):

  • Site-specific labeling of subunit b and potential interaction partners with fluorophore pairs

  • Measurement of energy transfer efficiency correlates with distance between subunits

  • Time-resolved FRET can detect dynamic changes during catalytic cycles

  • Particularly useful for studying b-δ and b-a interactions

• Cryo-Electron Microscopy:

  • High-resolution structural determination of the entire ATP synthase complex

  • Focused refinement on the peripheral stalk region containing subunit b

  • Computational analysis of conformational states

  • Integration with molecular dynamics simulations for complete mechanistic understanding

• Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

  • Maps solvent-accessible regions and conformational changes

  • Identifies regions of subunit b that become protected upon complex formation

  • Provides insight into dynamics of interactions

• Site-Directed Mutagenesis Combined with Functional Assays:

  • Targeted mutations at predicted interaction interfaces

  • Assessment of complex assembly and ATP synthesis activity

  • Correlation of structural perturbations with functional consequences

These complementary approaches together provide a comprehensive understanding of how subunit b functions within the complex molecular machine of ATP synthase.

How do genomic variations in the atpF gene across different C. urealyticum strains affect ATP synthase function?

Genomic variations in the atpF gene across different C. urealyticum strains can significantly impact ATP synthase function, with implications for bacterial metabolism, growth, and pathogenicity:

Understanding these variations is particularly relevant considering C. urealyticum's role as an opportunistic pathogen in urinary tract infections, where energy metabolism may influence persistence and antibiotic resistance.

What are the current challenges in expressing and purifying functionally active C. urealyticum ATP synthase subunit b?

The expression and purification of functionally active C. urealyticum ATP synthase subunit b presents several technical challenges that researchers must address:

• Membrane Protein Expression Barriers:

  • The hydrophobic N-terminal domain often leads to inclusion body formation

  • Potential toxicity to host cells when overexpressed

  • Challenges in proper membrane integration in heterologous expression systems

  • Difficulty achieving correct post-translational modifications

• Optimized Expression Strategies:

  • Induction conditions: Lower temperatures (16-20°C) and reduced inducer concentrations improve folding

  • Specialized host strains: E. coli C43(DE3) or Lemo21(DE3) strains designed for membrane protein expression

  • Fusion partners: MBP, SUMO, or Mistic fusion tags can improve solubility and membrane targeting

  • Specialized vectors: Those containing RBS modifications for controlled expression rates

• Purification Challenges:

  • Detergent selection: Finding detergents that maintain native structure while effectively solubilizing

  • Stability during purification: Preventing aggregation throughout multiple purification steps

  • Heterogeneity: Separating properly folded protein from misfolded species

  • Tag interference: Affinity tags may impact structure or function if not properly placed or removed

• Functional Assessment Complications:

  • Subunit b functions as part of a complex, making isolated functional assays difficult

  • Need for reconstitution with other subunits to assess true functionality

  • Challenge of distinguishing between structural defects and functional impairments

• Quality Control Metrics:

  • Circular dichroism (CD) spectroscopy: Assesses secondary structure content

  • Size exclusion chromatography with multi-angle light scattering (SEC-MALS): Confirms proper oligomeric state

  • Thermal shift assays: Evaluates stability under various buffer conditions

  • Limited proteolysis: Identifies properly folded domains resistant to proteolytic digestion

Researchers can mitigate these challenges by implementing systematic optimization strategies, including combinatorial screening of expression conditions, detergent types, and buffer compositions to identify conditions that maximize yield of properly folded, functional protein.

How can C. urealyticum ATP synthase subunit b be utilized in synthetic biology applications?

C. urealyticum ATP synthase subunit b offers versatile applications in synthetic biology, particularly in creating artificial energy-generating systems and novel bioengineered structures:

• Artificial Cellular Powerplants:
  Research has demonstrated that ATP synthase components can be incorporated into artificial membrane systems to create light-powered ATP generation. When combined with bacteriorhodopsin (bR), these systems can achieve ATP synthesis rates of 8.3 ± 0.3 s⁻¹ and produce approximately 0.6 × 10⁶ ATP molecules per vesicle within 4 hours of illumination . C. urealyticum ATP synthase components could be employed in similar systems with potential advantages in stability or efficiency.

• Protein-Based Nanostructures:
  The structural properties of ATP synthase subunit b, particularly its ability to form stable dimeric coiled-coil structures, makes it valuable for designing self-assembling protein nanostructures with defined geometries. These could serve as scaffolds for:

  • Enzyme immobilization platforms

  • Drug delivery systems

  • Biomolecular sensing devices

• Minimal Cell Systems:
  ATP synthase is essential for providing energy in minimal cell designs. Using C. urealyticum ATP synthase subunit b in conjunction with other components allows for the creation of simplified energy-generating modules in minimal artificial cells. These systems have been demonstrated to power protein synthesis inside giant unilamellar vesicles (GUVs) using photosynthesized ATP .

• Methodological Implementation:

  • Component optimization: Engineering subunit b for improved stability or altered interaction properties

  • System integration: Combining with other energy-transducing components like light-harvesting proteins

  • Encapsulation strategies: Methods for incorporating ATP synthase complexes into various membrane systems

  • Energy coupling: Designing systems that link ATP production to specific synthetic biological processes

• Performance Metrics:

  • ATP synthesis rate (molecules per second)

  • Energy conversion efficiency (ATP produced per photon)

  • System longevity (functional half-life)

  • Coupling efficiency to downstream processes

These applications demonstrate how fundamental components of biological energy systems can be repurposed for novel synthetic biology applications, potentially enabling new approaches to bioenergy, sensing, and nanomedicine.

What are the recommended protocols for site-directed mutagenesis of C. urealyticum ATP synthase subunit b?

Site-directed mutagenesis of C. urealyticum ATP synthase subunit b requires careful planning and execution to ensure accurate introduction of specific mutations while maintaining the rest of the gene sequence intact:

• Mutagenesis Strategy Selection:

  Method	Advantages	Limitations	Recommended Use Case
  QuikChange PCR	Single-step process, high efficiency for simple mutations	Less effective for large insertions or multiple mutations	Single amino acid substitutions
  Gibson Assembly	Allows multiple simultaneous mutations, large insertions	More complex setup, requires multiple primers	Domain swapping, multiple mutations
  Golden Gate Assembly	Highly efficient, scarless	Requires absence of restriction sites in target gene	Complex mutagenesis projects
  CRISPR-Cas9	Direct genome editing if working in C. urealyticum	More complex setup, lower efficiency	In vivo studies

• Primer Design Considerations:

  • For point mutations, use primers of 25-45 nucleotides with the mutation centrally located

  • Ensure primers have GC content of 40-60% and terminate in G or C bases

  • Maintain melting temperature (Tm) between 75-85°C for QuikChange primers

  • Avoid secondary structures and primer-dimer formation

  • For the atpF gene (cu0712), codons should be optimized for the expression system while avoiding rare codons

• Recommended Protocol for QuikChange Mutagenesis:

  • Template: Plasmid containing wild-type C. urealyticum atpF gene

  • PCR mix: High-fidelity polymerase (e.g., Phusion or Q5), designed primers, dNTPs, buffer

  • Thermal cycling: Initial denaturation (98°C, 30s); 16 cycles of denaturation (98°C, 10s), annealing (55-65°C, 30s), extension (72°C, 30s/kb); final extension (72°C, 10min)

  • DpnI digestion: 1 hour at 37°C to remove methylated template DNA

  • Transformation into high-efficiency competent cells

• Verification Methods:

  • Sanger sequencing of the entire atpF gene to confirm the intended mutation and absence of off-target changes

  • Restriction enzyme analysis if the mutation creates or removes a restriction site

  • Mismatch amplification mutation assay (MAMA-PCR) for rapid screening of multiple clones

• Mutation Target Recommendations:
  Based on sequence analysis of C. urealyticum ATP synthase subunit b , key regions for functional studies include:

  • The N-terminal membrane anchor (residues 1-30)

  • The predicted dimerization interface

  • Residues involved in interaction with the δ and a subunits

These approaches ensure precise genetic manipulation of the atpF gene, enabling structure-function studies of C. urealyticum ATP synthase subunit b.

How can researchers assess the impact of environmental conditions on C. urealyticum ATP synthase function?

Assessing the impact of environmental conditions on C. urealyticum ATP synthase function requires a systematic approach that evaluates both in vitro activity and whole-cell energetics:

These methodologies provide comprehensive insights into how environmental conditions affect C. urealyticum ATP synthase function, with implications for understanding bacterial adaptation to diverse ecological niches and potential development of targeted antimicrobials.

What imaging techniques are most effective for visualizing C. urealyticum ATP synthase subunit b in cellular contexts?

Visualizing C. urealyticum ATP synthase subunit b in cellular contexts requires advanced imaging techniques that provide sufficient resolution while preserving biological context:

• Super-Resolution Fluorescence Microscopy:

  • Stimulated Emission Depletion (STED) Microscopy:

    • Resolution down to 20-50 nm, sufficient to resolve individual ATP synthase complexes

    • Requires fluorophore-labeled antibodies against subunit b or genetic fusion with fluorescent proteins

    • Particularly effective for visualizing membrane distribution patterns

  • Single-Molecule Localization Microscopy (PALM/STORM):

    • Achieves 10-20 nm resolution through sequential activation and localization

    • Enables quantitative assessment of protein copy numbers and clustering

    • Recommended protocol includes cell fixation, permeabilization, and immunolabeling with primary antibodies against subunit b and fluorophore-conjugated secondary antibodies

• Correlative Light and Electron Microscopy (CLEM):

  • Combines fluorescence specificity with EM ultrastructural detail

  • Workflow includes:

    • Genetic fusion of subunit b with fluorescent protein or FlAsH/ReAsH tags

    • Live-cell fluorescence imaging to locate protein of interest

    • Sample processing for electron microscopy

    • Correlation of images to provide contextual ultrastructure

• Cryo-Electron Tomography:

  • Enables visualization of ATP synthase in native membrane environment

  • Resolution of 3-5 nm achievable with subtomogram averaging

  • Sample preparation involves:

    • Growing C. urealyticum on EM grids

    • Flash-freezing in liquid ethane

    • Data collection with tilt series

    • Computational reconstruction and subtomogram averaging

• Expansion Microscopy:

  • Physical expansion of specimens to achieve effective super-resolution with standard microscopes

  • Protocol adaptation for bacterial cells requires:

    • Modified fixation for bacterial cell walls

    • Immunolabeling of subunit b

    • Embedding in expandable hydrogel

    • Digestion of cell components

    • Isotropic expansion before imaging

• Proximity Labeling Approaches:

  • APEX2 or BioID fusion to subunit b:

    • Enables visualization of proximal proteins in the complex

    • Identifies interaction partners in native cellular environment

    • Detection through streptavidin-fluorophore conjugates

• Live-Cell Imaging Considerations:

  • Genetic fusion of subunit b with mNeonGreen or HaloTag

  • Integration of fusion construct at native locus to maintain physiological expression

  • Minimally invasive imaging conditions to prevent phototoxicity

  • Time-lapse imaging to monitor dynamic changes in localization

• Quantitative Image Analysis:

  • Determination of spatial distribution patterns

  • Colocalization analysis with other respiratory complex components

  • Assessment of membrane microdomain association

  • Cluster analysis to determine oligomerization states

These imaging approaches provide complementary information about C. urealyticum ATP synthase subunit b localization, dynamics, and interactions within the cellular context, enabling a comprehensive understanding of its biological function.

What computational approaches can predict structural features and interaction sites of C. urealyticum ATP synthase subunit b?

Computational approaches offer powerful tools for predicting structural features and interaction sites of C. urealyticum ATP synthase subunit b, providing valuable insights for experimental design:

• Protein Structure Prediction:

  • AlphaFold2 and RoseTTAFold:

    • State-of-the-art deep learning approaches for high-accuracy structure prediction

    • Input: C. urealyticum atpF sequence (B1VFY3)

    • Output: Predicted three-dimensional structure with confidence scores

    • Special consideration: The membrane-embedded N-terminal domain may require specialized prediction protocols

  • Homology Modeling:

    • Templates: Crystal structures of b subunits from related species (e.g., E. coli, Mycobacterium)

    • Software: MODELLER, SWISS-MODEL, Phyre2

    • Validation: PROCHECK, VERIFY3D for stereochemical quality assessment

• Molecular Dynamics Simulations:

  • Membrane Protein Simulation:

    • Incorporation of predicted structure into a lipid bilayer using CHARMM-GUI

    • Simulation packages: GROMACS, NAMD, or AMBER

    • Analysis: Stability of secondary structure elements, flexibility regions, lipid interactions

    • Recommended simulation time: 500 ns - 1 μs for adequate sampling

  • Enhanced Sampling Methods:

    • Umbrella sampling to investigate conformational transitions

    • Replica exchange molecular dynamics to explore conformational space

    • Focus on the hinge region connecting membrane and cytoplasmic domains

• Protein-Protein Interaction Prediction:

  • Coevolution Analysis:

    • Methods: Direct Coupling Analysis (DCA), GREMLIN

    • Input: Multiple sequence alignment of atpF homologs across species

    • Output: Residue pairs likely to be in contact due to coevolutionary constraints

  • Protein-Protein Docking:

    • Software: HADDOCK, ClusPro, ZDOCK

    • Target interactions: b-δ, b-a, b-b dimerization

    • Constraint-guided docking using coevolutionary information

    • Refinement with molecular dynamics

• Functional Site Prediction:

  • Conserved Domain Analysis:

    • Search against Pfam, CDD, SMART databases

    • Identification of functional motifs within the 186-amino acid sequence

  • Analysis of Evolutionary Conservation:

    • Tools: ConSurf, Evolutionary Trace

    • Mapping of conserved residues onto the predicted structure

    • Identification of functionally important surface patches

• Membrane Topology Prediction:

  • Transmembrane Helix Prediction:

    • Methods: TMHMM, Phobius, TOPCONS

    • Expected output: Identification of the membrane-spanning N-terminal segment

    • Integration with structural models

• Statistical Coupling Analysis:

  • Detection of allosteric networks within the protein structure

  • Identification of residues involved in long-range communication

  • Implications for energy transfer mechanisms

• Integrative Modeling Workflow:

  Step	Methods	Output	Validation
  1. Sequence analysis	PSI-BLAST, HHpred	Homologous sequences	Sequence coverage, E-values
  2. Secondary structure prediction	PSIPRED, JPred	Helical regions, coiled-coils	Agreement between methods
  3. Tertiary structure prediction	AlphaFold2, homology modeling	3D structural model	pLDDT scores, RMSD to templates
  4. Membrane integration	CHARMM-GUI Membrane Builder	Protein-membrane complex	Hydrophobic matching
  5. Complex assembly	Multi-component docking	ATP synthase peripheral stalk	Cross-linking constraints
  6. Dynamic behavior	Molecular dynamics	Conformational ensemble	RMSF, principal component analysis

These computational approaches provide a comprehensive framework for understanding the structural and functional properties of C. urealyticum ATP synthase subunit b, generating testable hypotheses for experimental validation.

How can researchers develop inhibitors targeting C. urealyticum ATP synthase subunit b for potential therapeutic applications?

Developing inhibitors targeting C. urealyticum ATP synthase subunit b for therapeutic applications requires a systematic drug discovery approach combining structural insights, computational methods, and experimental validation:

• Target Site Identification:

  • Structure-Based Analysis:

    • Identify druggable pockets using computational tools (SiteMap, fpocket)

    • Focus on:

      • The interface between subunit b and subunit δ

      • Dimerization interface between b subunits

      • Critical regions for conformational flexibility

    • Analyze the 186-amino acid sequence for unique regions that differ from human ATP synthase

  • Network Analysis Approach:

    • Identify allosteric sites that could disrupt energy transfer

    • Target regions essential for maintaining the peripheral stalk rigidity

• Virtual Screening Workflow:

  • Compound Library Selection:

    • Antimicrobial-focused libraries

    • Natural product collections

    • Fragment libraries for fragment-based drug design

  • Molecular Docking:

    • Software: DOCK, AutoDock Vina, Glide

    • Ensemble docking using multiple conformations from MD simulations

    • Scoring functions calibrated for protein-protein interaction disruptors

  • Pharmacophore-Based Screening:

    • Develop pharmacophore models based on essential interactions

    • Screen virtual libraries for compounds matching these features

• Rational Design Strategies:

  • Peptide Mimetics:

    • Design peptides mimicking critical interface regions

    • Introduce stabilizing modifications (cyclization, non-natural amino acids)

    • Optimize for membrane permeability

  • Fragment Growing/Linking:

    • Identify small molecules binding to adjacent sites

    • Chemical linking to create higher-affinity compounds

• In Vitro Evaluation Pipeline:

  • Binding Assays:

    • Surface plasmon resonance (SPR) to measure direct binding to subunit b

    • Thermal shift assays to detect compound-induced stabilization

    • Microscale thermophoresis for binding affinity determination

  • Functional Assays:

    • ATP synthesis inhibition in reconstituted proteoliposomes

    • Proton translocation measurement using pH-sensitive dyes

    • ATP synthase complex assembly assessment

• Selectivity Profiling:

  • Comparative binding studies with human ATP synthase components

  • Counter-screening against other bacterial ATP synthases

  • Safety assessment in mammalian cell lines

• Optimization Strategies:

  • Structure-activity relationship (SAR) development

  • Physiochemical property optimization for bacterial penetration

  • Metabolic stability assessment and improvement

• Lead Compound Validation:

  Validation Level	Methods	Success Criteria
  Biochemical	FRET-based disruption of b-δ interaction	IC₅₀ < 10 μM
  Bacterial growth	Growth inhibition of C. urealyticum	MIC < 32 μg/ml
  Mechanism verification	ATP depletion in treated cells	>50% reduction in ATP levels
  Selectivity	Human cell toxicity	Selectivity index >10
  In vivo efficacy	Mouse infection model	Significant reduction in bacterial burden

• Resistance Development Assessment:

  • Serial passage studies to evaluate resistance emergence

  • Whole genome sequencing of resistant strains

  • Structural analysis of resistance mutations

This comprehensive approach enables the development of selective inhibitors targeting C. urealyticum ATP synthase subunit b, potentially leading to novel therapeutic options for treating infections caused by this opportunistic pathogen, particularly in challenging cases of urinary tract infections where this organism's multidrug resistance is problematic.