Recombinant Corynorhinus rafinesquii Cytochrome b (MT-CYB)

Shipped with Ice Packs
In Stock

Description

Functional Role in Mitochondrial Complex III

MT-CYB is a core subunit of mitochondrial Complex III (ubiquinol-cytochrome c reductase), facilitating electron transfer from ubiquinol to cytochrome c and proton translocation across the inner mitochondrial membrane . Key functional insights:

  • Oxidative Phosphorylation: Mutations in MT-CYB disrupt ATP synthesis, leading to energy deficits in high-demand tissues (e.g., heart, muscle) .

  • Pathogenic Variants:

    • M4T (m.14757T>C): Linked to dilated cardiomyopathy via impaired Complex III assembly .

    • C40R (m.14864T>C): Associated with MELAS-like encephalomyopathy and neuropathy .

Table 1: Key Mutations and Phenotypic Associations

VariantClinical PhenotypeMechanismSource
m.14757T>C (M4T)Dilated cardiomyopathyReduced Complex III activity (<30% of normal)
m.14864T>C (C40R)Epilepsy, neuropathy, strokelike episodesDisrupted heme coordination in Q<sub>o</sub> site
rs527236194Male infertilityAltered sperm motility and mitochondrial function
p.Asp171AsnEnhanced atovaquone sensitivityStructural destabilization of Q<sub>o</sub> pocket

Table 2: Functional Impact of MT-CYB Variants

SNPEffect on Complex IIIDrug Response
p.Phe18LeuIncreased clomipramine sensitivityAltered Q<sub>i</sub> site conformation
p.Gly251AspHistiocytoid cardiomyopathyDisrupted cytochrome b assembly

Applications in Biomedical Research

  • Disease Modeling: Used to study mitochondrial disorders (e.g., cardiomyopathy, exercise intolerance) .

  • Drug Discovery: Variants like p.Asp171Asn serve as models for antimalarial (atovaquone) and antidepressant (clomipramine) efficacy studies .

  • Fertility Studies: SNPs (e.g., rs527236194) correlate with idiopathic male infertility via impaired sperm motility .

Limitations and Future Directions

  • Functional Studies: Most variants lack mechanistic validation in mammalian systems .

  • Population Studies: Larger cohorts are needed to confirm infertility associations .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate your requirement when placing the order. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
MT-CYB; COB; CYTB; MTCYB; Cytochrome b; Complex III subunit 3; Complex III subunit III; Cytochrome b-c1 complex subunit 3; Ubiquinol-cytochrome-c reductase complex cytochrome b subunit; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-176
Protein Length
full length protein
Species
Corynorhinus rafinesquii (Rafinesque's big-eared bat) (Plecotus rafinesquii)
Target Names
Target Protein Sequence
MTNIRKSHPLLKIINDSFIDLPTPSNISSWWNFGSLLGICLVLQISTGLFLAMHYTSDTA TAFNSVTHISRDVNYGWVLRYLHANGASMFFICLYLHVGRGLYYGSYLYKETWNVGVILL FATMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTDLVEWIWGGFSVDKATLT
Uniprot No.

Target Background

Function
Cytochrome b (MT-CYB) is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. The b-c1 complex facilitates electron transfer from ubiquinol to cytochrome c. It contributes to the generation of a proton gradient across the mitochondrial membrane, which is subsequently utilized for ATP synthesis.
Protein Families
Cytochrome b family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Corynorhinus rafinesquii Cytochrome b and why is it significant in phylogenetic research?

Corynorhinus rafinesquii Cytochrome b (MT-CYB) is a mitochondrial gene encoding a protein critical for cellular respiration in the Rafinesque's big-eared bat. This gene holds particular significance in phylogenetic studies due to its relatively slow evolutionary rate, making it suitable for resolving relationships among closely related taxa. In phylogenetic analyses, C. rafinesquii is often used as an outgroup when studying related bat species, as demonstrated in recent molecular studies of bat taxonomy . The gene's sequence contains sufficient variability to allow discrimination between species while maintaining enough conservation to establish evolutionary relationships, making it invaluable for taxonomic investigations and species delineation studies.

Mitochondrial cytochrome b genes are commonly employed in mammalian systematics due to their maternal inheritance pattern and absence of recombination, allowing researchers to trace maternal lineages with high accuracy. In bat species specifically, MT-CYB sequences have revealed previously unrecognized cryptic diversity and clarified evolutionary relationships that were difficult to resolve using morphological characteristics alone .

What are standard protocols for extracting and amplifying Corynorhinus rafinesquii MT-CYB?

The extraction of high-quality DNA containing MT-CYB from Corynorhinus rafinesquii typically employs commercial tissue-specific DNA isolation kits following manufacturer protocols with minor modifications. According to recent research methodologies, the ReliaPrepTM gDNA Tissue Miniprep System has been successfully employed for DNA extraction from bat tissue samples . The standard protocol involves:

  • Tissue homogenization in lysis buffer

  • Protein digestion with proteinase K

  • DNA binding to silica membranes

  • Washing to remove contaminants

  • Elution in molecular-grade water (100-200 μL) rather than provided elution buffers to increase downstream application flexibility

For PCR amplification, specific primers targeting MT-CYB are employed in a reaction mixture typically containing 2 μl of template DNA (50-200 ng/μl), 1 μl of each primer (10mM), 15 μl of Master Mix RED, and 6 μl of PCR-grade water . Amplification is performed in thermal cyclers with protocols optimized for the specific primers. Negative controls without template DNA should be included in every PCR round to verify the absence of contamination. Following amplification, sequencing is typically performed using both forward and reverse PCR primers to ensure sequence accuracy and completeness .

How can researchers evaluate sequence quality and perform initial data processing?

Evaluating sequence quality and performing initial data processing for MT-CYB sequences involves several critical steps:

  • Raw sequence editing: Software tools such as SEQUENCHER® are used to trim low-quality regions, resolve ambiguous bases, and merge forward and reverse reads into a consensus sequence .

  • Sequence alignment: Multiple sequence alignment is performed using algorithms such as Clustal W implemented in programs like MEGA X to align the newly generated sequences with reference sequences from databases .

  • Model selection: For phylogenetic analysis, appropriate nucleotide substitution models must be selected for each codon position. Common models for cytochrome b analysis include HKY+Γ for first codon positions, HKY+I for second positions, and TN+I for third positions .

  • Haplotype identification: Software like DnaSP v.6 can be used to identify unique haplotypes within the sequence dataset, which is essential for population genetic analyses .

  • Quality metrics: Sequence quality should be assessed through metrics such as PHRED scores, chromatogram analysis, and comparison with known sequences from the same species to identify potential sequencing errors or contamination.

What methodological approaches are recommended for phylogenetic analysis using Corynorhinus rafinesquii MT-CYB?

Phylogenetic analysis using Corynorhinus rafinesquii MT-CYB sequences requires sophisticated methodological approaches to ensure accurate evolutionary inferences. Recent research employs dual analytical strategies:

  • Maximum Likelihood (ML) analysis: Implemented through software such as IQTREE2, ML analysis estimates the most likely evolutionary tree given the observed sequence data. For MT-CYB analysis, a partitioning scheme is critical, with separate models applied to different codon positions. Recent studies have employed schemes such as:

    • First position Cyt-b: HKY+Γ model

    • Second position Cyt-b: HKY+I model

    • Third position Cyt-b: TN+I model

  • Bayesian Inference (BI): Implemented through software like BEAST2, BI provides a probability distribution of possible trees rather than a single best estimate. This approach is particularly valuable for estimating divergence times and assessing support for specific clades. The same partitioning scheme used in ML analysis is typically applied, with appropriate priors selected based on existing knowledge of bat evolution .

For optimal results, researchers should perform incongruence testing before concatenating MT-CYB with other genes, as was demonstrated in recent studies using the BIONJ-ILD test implemented in MLSTests software . This prevents topological conflicts that could arise from genes with different evolutionary histories.

How can researchers optimize heterologous expression of recombinant Corynorhinus rafinesquii MT-CYB?

Heterologous expression of recombinant MT-CYB presents significant challenges due to its hydrophobic nature and membrane association. Based on protocols developed for similar cytochrome proteins, the following optimization strategies are recommended:

  • Expression system selection: The E. coli strain C41, a derivative of E. coli DE3, has shown marked success in expressing membrane-bound cytochromes with reproducible overexpression . This strain contains mutations that prevent the toxicity often associated with membrane protein overexpression.

  • Vector design: Vectors should include:

    • A strong, inducible promoter (typically T7)

    • Appropriate fusion tags for purification and detection

    • Codon optimization for E. coli expression

    • Signal sequences if secretion is desired

  • Expression conditions: Optimization of:

    • Induction timing (typically at mid-log phase)

    • Inducer concentration (IPTG typically at 0.1-1.0 mM)

    • Post-induction temperature (often lowered to 16-25°C to facilitate proper folding)

    • Culture media enrichment with δ-aminolevulinic acid as a heme precursor

  • Purification strategy: For membrane-associated proteins like MT-CYB, a two-phase extraction approach is recommended, involving:

    • Initial membrane isolation through differential centrifugation

    • Detergent solubilization (mild detergents like DDM or CHAPS)

    • Affinity chromatography using engineered tags

    • Size exclusion chromatography for final purification

What approaches are recommended for studying mutations and functional variations in Corynorhinus rafinesquii MT-CYB?

Studying mutations and functional variations in MT-CYB requires multidisciplinary approaches that integrate molecular, biochemical, and computational methods:

  • Sequence conservation analysis: Comparing MT-CYB sequences across multiple bat species and other mammals identifies highly conserved regions that likely have critical functional roles. Mutations in these regions generally have greater functional consequences .

  • Heteroplasmy assessment: For mitochondrial genes like MT-CYB, determining the degree of heteroplasmy (presence of both wild-type and mutant mitochondrial DNA) is essential, as demonstrated in clinical studies of MTCYB mutations . This requires deep sequencing approaches and careful quantification of sequence variants in different tissue types.

  • Structure-function prediction: Computational modeling of how amino acid substitutions affect protein structure and function can provide insights into the potential impact of mutations. This is particularly valuable for mutations affecting highly conserved residues, such as the cysteine to arginine change documented in human MTCYB studies .

  • Recombinant expression of variants: Expressing different MT-CYB variants in suitable systems allows direct comparison of their functional properties, including:

    • Electron transfer efficiency

    • Protein stability

    • Interaction with other respiratory complex components

    • Response to inhibitors or environmental stressors

How can MT-CYB data be effectively used for population genetic analysis of Corynorhinus rafinesquii?

MT-CYB data provides valuable insights into the population structure and evolutionary history of Corynorhinus rafinesquii. Recent methodological approaches include:

  • Haplotype network analysis: Using algorithms such as Median Joining implemented in software like POPART to visualize relationships among haplotypes and identify potential geographical patterns in genetic variation .

  • Population structure analysis: Software such as GENELAND and STRUCTURE can be employed to infer spatial genetic discontinuities and population subdivisions. For optimal results, these analyses should test multiple potential population structures (typically from k=1 to k=10 subdivisions) with multiple independent runs .

  • Neutrality testing: Statistical tests such as Tajima's D and Fu's Fs can be used to test for signatures of selection or demographic changes in MT-CYB sequences .

  • Analysis of molecular variance (AMOVA): This approach, which partitions genetic variation among different hierarchical levels (within populations, among populations within groups, among groups), can reveal how genetic diversity is structured across the species' range .

HypothesisSource of variationVariance components% VariationFixation indexp-value
Two groups (SMO vs SMOC-TMVB)Among groups48.6806785.17Fct 0.851710.023
Among populations within groups6.6728811.67Fsc 0.78728< 0.001
Within populations1.803013.15Fst 0.96845< 0.001
Three groups (SMO vs SMOC vs TMVB)Among groups23.3764984.27Fct 0.842740.003
Among populations within groups2.559079.23Fsc 0.58666< 0.001
Within populations1.803016.50Fst 0.93500< 0.001

As shown in this example AMOVA table from bat population studies, different population grouping hypotheses can be tested to determine which best explains the observed genetic variation .

What methods are recommended for calibrating molecular clocks and estimating divergence times using MT-CYB?

Estimating divergence times using MT-CYB sequences requires careful calibration of molecular clocks. Recommended methodological approaches include:

  • Calibration point selection: Using well-established divergence events from the fossil record or biogeographical events. For bat phylogenies, calibration points often include:

    • Divergence between Plecotus and Corynorhinus genera (approximately 6.585 ± 0.387 million years ago)

    • Origin of the Corynorhinus crown group (approximately 5.09 ± 0.86 million years ago)

  • Model selection: Implementing appropriate evolutionary models for each codon position, such as:

    • HKY+Γ for first and second codon positions

    • TN93+I for third positions

  • Clock model selection: Using relaxed molecular clock models (typically lognormal) that allow substitution rates to vary across branches, which is more realistic for datasets spanning millions of years of evolution .

  • Speciation model selection: Implementing appropriate speciation models, such as the Yule speciation model, which assumes a constant speciation rate and no extinction .

  • Bayesian MCMC analysis: Running multiple independent chains (typically four) with millions of generations (e.g., 10 million) to ensure convergence, sampling trees at regular intervals (e.g., every 1000 generations), and applying an appropriate burn-in percentage (typically 10%) to discard initial samples before the chains reach stationarity .

  • Convergence assessment: Verifying chain convergence and effective sample sizes (ESS > 200) using software like Tracer to ensure reliable estimates .

How can researchers integrate MT-CYB data with other molecular markers for comprehensive phylogenetic analysis?

Integrating MT-CYB data with other molecular markers provides a more comprehensive understanding of evolutionary relationships. Recommended methodological approaches include:

  • Marker selection: Combining MT-CYB with other markers that provide complementary phylogenetic signals:

    • Mitochondrial markers (e.g., COI) for recent divergences and maternal lineage tracking

    • Nuclear markers (e.g., RAG2) for deeper phylogenetic relationships and to account for potential mitochondrial introgression

  • Incongruence testing: Assessing phylogenetic signal compatibility between markers before concatenation using tests such as:

    • BIONJ-ILD test for general incongruence

    • NJ-LILD test for localized branch incongruence

    • Modified Templeton test to evaluate statistical significance of incongruence

  • Partition schemes: Implementing appropriate partition schemes that account for the heterogeneous evolutionary processes across markers and codon positions. Optimal partition schemes can be determined using algorithms like PartitionFinder based on information criteria such as BIC .

  • Separate analyses: When significant incongruence is detected, analyzing markers separately before attempting to reconcile resulting phylogenies. For example, nuclear and mitochondrial data might be analyzed independently when they show conflicting signals .

  • Species tree methods: Implementing coalescent-based species tree methods (e.g., *BEAST, ASTRAL) that explicitly account for gene tree heterogeneity when combining data from multiple loci.

How is next-generation sequencing changing approaches to MT-CYB research in Corynorhinus rafinesquii?

Next-generation sequencing (NGS) technologies are revolutionizing MT-CYB research in Corynorhinus rafinesquii through several methodological advancements:

  • Whole mitogenome sequencing: NGS platforms like Illumina enable sequencing of entire mitochondrial genomes rather than just individual genes. This approach provides substantially more phylogenetic information and allows for more robust evolutionary analyses . Recent studies have used Illumina sequencing to obtain complete mitogenomes from Corynorhinus species, with subsequent exclusion of highly variable regions (nad6 gene and control region) for phylogenomic analyses .

  • Partition schemes for mitogenomic data: When analyzing complete mitogenomes, sophisticated partition schemes are implemented:

    • One partition for both ribosomal RNAs (12S and 16S)

    • One partition for all transfer RNAs

    • Three partitions for each protein-coding gene, representing the three codon positions

  • Deep sequencing for heteroplasmy detection: NGS enables the detection of low-frequency mitochondrial variants that would be missed by Sanger sequencing. This is particularly important for studying potential heteroplasmy in bat populations and understanding the dynamics of mitochondrial mutations.

  • Environmental DNA (eDNA) approaches: Emerging technologies allow MT-CYB sequences to be obtained from environmental samples (e.g., guano deposits in caves), enabling non-invasive monitoring of bat populations and community composition.

  • Long-read sequencing technologies: Platforms like Oxford Nanopore and PacBio facilitate the sequencing of long mtDNA fragments, reducing assembly challenges and providing better resolution of repetitive regions.

What bioinformatic challenges exist in analyzing MT-CYB sequence data from Corynorhinus rafinesquii?

Analysis of MT-CYB sequence data presents several bioinformatic challenges that researchers must address through methodological solutions:

  • Nuclear mitochondrial DNA segments (NUMTs): These nuclear pseudogenes can be inadvertently amplified alongside genuine mitochondrial sequences. Detection methods include:

    • Examining sequences for unexpected stop codons or frameshift mutations

    • Comparing patterns of codon bias with established mitochondrial sequences

    • Using mitochondria-specific enrichment methods before sequencing

  • Heteroplasmy detection and quantification: Distinguishing true heteroplasmy from sequencing errors requires:

    • Sufficient sequencing depth (typically >100x coverage)

    • Application of error correction algorithms

    • Conservative threshold setting for variant calling

  • Model selection for phylogenetic analysis: Different regions of MT-CYB evolve at different rates, necessitating careful model selection. Recent analyses have employed partitioning by codon position with specific models for each partition:

    • First position: HKY+Γ

    • Second position: HKY+I

    • Third position: TN+I

  • Handling missing data: When comparing sequences from multiple studies or databases, handling missing data appropriately is crucial. Approaches include:

    • Character-based methods that code missing data as unresolved

    • Likelihood methods that marginalize over missing data

    • Imputation approaches based on phylogenetic position

  • Saturation at third codon positions: The third codon position in MT-CYB can become saturated with mutations over evolutionary time, potentially misleading phylogenetic analyses. Solutions include:

    • Recoding third positions as purines/pyrimidines

    • Downweighting third positions in analyses

    • Exclusion of third positions for analyses of deeply divergent lineages

How can researchers integrate MT-CYB data with morphological analyses for comprehensive taxonomic studies?

  • Geometric morphometrics: Modern morphological analysis using landmark-based approaches to quantify shape variations can be correlated with MT-CYB genetic distances. This allows researchers to determine whether morphological differences correspond to genetic divergence patterns .

  • Total evidence phylogenetics: Combining morphological characters and molecular data in a single phylogenetic analysis provides a comprehensive view of evolutionary relationships. Software packages like MrBayes allow for simultaneous analysis of discrete morphological characters and molecular sequence data.

  • Character mapping: Mapping morphological traits onto molecular phylogenies using methods such as ancestral state reconstruction helps identify which morphological characters are phylogenetically informative and which might be subject to convergent evolution.

  • Congruence testing: Comparing trees derived from morphological data with those from MT-CYB sequences using metrics such as Robinson-Foulds distances or incongruence length difference tests helps determine whether different data types support similar evolutionary hypotheses .

  • Integrative taxonomy frameworks: Employing decision frameworks that establish explicit criteria for species delimitation based on multiple data types. These typically require concordant patterns across independent data sets (e.g., mitochondrial, nuclear, morphological) before taxonomic changes are proposed.

What methodological considerations are important when using MT-CYB for conservation genetics of Corynorhinus rafinesquii?

Conservation genetic studies of Corynorhinus rafinesquii using MT-CYB require specific methodological considerations:

  • Sampling strategy: Implementing geographically comprehensive sampling that:

    • Covers the entire species range

    • Includes multiple individuals per population (typically 5-10 minimum)

    • Prioritizes sampling of fragmented or threatened populations

    • Uses minimally invasive sampling techniques (e.g., wing membrane biopsies)

  • Genetic diversity metrics: Calculating appropriate metrics for conservation assessment:

    • Haplotype diversity (h)

    • Nucleotide diversity (π)

    • Private haplotype frequency

    • Divergence between populations (FST, ΦST)

  • Demographic history inference: Implementing tests and analyses to detect historical population changes:

    • Neutrality tests (Tajima's D, Fu's Fs) to detect population expansions or bottlenecks

    • Mismatch distribution analysis to identify signals of historical demographic changes

    • Bayesian skyline plots to reconstruct historical effective population size changes

  • Designation of conservation units: Using genetic data to identify:

    • Evolutionary Significant Units (ESUs) based on reciprocal monophyly

    • Management Units (MUs) based on significant differentiation in allele frequencies

    • Adaptive units based on evidence of local adaptation

  • Integration with landscape genetics: Correlating genetic patterns with landscape features to identify:

    • Barriers to gene flow

    • Potential corridor areas

    • Habitat features associated with genetic diversity

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.