Recombinant Cottinella boulengeri Rhodopsin (rho)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Recombinant C. boulengeri Rho refers to the genetically engineered form of the visual pigment expressed in heterologous systems such as E. coli or yeast. Native Rho in C. boulengeri functions as a photoreceptor, utilizing 3-dehydroretinal (in freshwater fish) or retinal as its chromophore. Light-induced isomerization of 11-cis retinal activates signaling via G-proteins, enabling phototransduction .

Recombinant Production

Recombinant C. boulengeri Rho is typically produced in E. coli with an N-terminal His-tag for purification. Key parameters include:

ParameterDetail
Host SystemE. coli (e.g., BL21 strains)
TagHexahistidine (His-tag)
Purity>90% (verified by SDS-PAGE)
StorageLyophilized in Tris/PBS buffer with 6% trehalose (pH 8.0)
ReconstitutionDeionized water + 50% glycerol for long-term stability

This system enables high-yield production for biochemical assays and structural studies .

4.2. Disease Modeling

  • Retinal Degeneration: Mislocalization mutants (e.g., P23H) are employed to model autosomal dominant RP, revealing mechanisms of protein aggregation and proteasomal degradation .

  • Pharmacological Chaperones: Screens for compounds like YC-001 that restore Rho folding in RP models .

4.3. Therapeutic Development

  • Gene Therapy: Dual-purpose vectors combining RNA interference and wild-type Rho delivery are tested to suppress mutant alleles while restoring function .

Comparative Analysis of Recombinant Rhodopsins

SpeciesHost SystemTagLength (aa)Key Use
C. boulengeri (Sculpin)E. coliHis-tagPartial (1-348)Phototransduction studies
Mus musculus (Mouse)E. coliHis-tagFull (1-348)Retinal degeneration models
Sus scrofa (Pig)E. coliHis-tagFull (1-348)Structural resolution (e.g., PDB IDs)

Challenges and Future Directions

  • Misfolding Mutants: Dominant-negative mutants like Rho∆I256 trap wild-type Rho in aggregates, complicating therapeutic strategies .

  • Species-Specific Variations: Chromophore preferences (retinal vs. 3-dehydroretinal) require tailored assays for functional analysis .

  • Gene Editing: CRISPR and antisense oligonucleotides (ASOs) are explored to selectively suppress mutant Rho while preserving wild-type function .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them during order placement and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All protein shipments are standardly packaged with blue ice packs. If dry ice shipping is required, please communicate with us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Synonyms
rho; Rhodopsin; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-289
Protein Length
full length protein
Species
Cottinella boulengeri (Short-headed sculpin) (Abyssocottus boulengeri)
Target Names
rho
Target Protein Sequence
YLVNPAAYAALGAYMFLLILIGFPINFLTLYVTLEHKKLRTPLNYILLNLAVGNLFMVLG GFTTTMYTSMHGYFVLGRLGCNLEGFFATLGGEIALWSLVVLAIERWIVVCKPISKFRFT EDHAIMGLAFSWVMGLACAVPPLVGWSRYIPEGMKCSCGVDYYTRAEGFNNESFVIYMFI VHFLIPLSVIFFCYGRLLCAVKEAAAAQQESETTQRAEKEVSRMVVIMVIGFLVCWLPYA SVAWWIFCNQGSDFGPIFMTLPSFFAKRPAIYNPMIYICMNKQFRHCMI
Uniprot No.

Target Background

Function
Photoreceptor essential for image-forming vision under low light conditions. While most saltwater fish species use retinal as a chromophore, most freshwater fish utilize 3-dehydroretinal, or a combination of retinal and 3-dehydroretinal. Light-induced isomerization of 11-cis to all-trans retinal triggers a conformational change, activating signaling via G-proteins. Subsequent receptor phosphorylation mediates the displacement of the bound G-protein alpha subunit by arrestin, terminating signaling.
Protein Families
G-protein coupled receptor 1 family, Opsin subfamily
Subcellular Location
Membrane; Multi-pass membrane protein. Cell projection, cilium, photoreceptor outer segment.

Q&A

Basic Structure and Properties of Cottinella boulengeri Rhodopsin

Q: What is the basic structure of Cottinella boulengeri Rhodopsin and how does it compare to other species?

A: Cottinella boulengeri Rhodopsin (opsd_cotbo) is a Class A G protein-coupled receptor (GPCR) belonging to the sensory rhodopsin family. Like other vertebrate rhodopsins, it features seven transmembrane domains (TM1-TM7) with intracellular loops (ICLs) and extracellular loops (ECLs) connecting them. The protein consists of 348 amino acids and contains a conserved lysine residue in TM7 that forms a Schiff base with 11-cis-retinal chromophore .

Comparative analysis of C. boulengeri rhodopsin shows high sequence homology with other species, particularly in the retinal-binding pocket and G-protein interaction domains. Key structural features include:

  • Seven α-helical transmembrane domains

  • Three extracellular loops (ECL1-3) and three intracellular loops (ICL1-3)

  • A cytoplasmic C-terminal domain containing an amphipathic helix (H8)

  • Highly conserved residues involved in chromophore binding

The amino acid sequence contains several conserved motifs critical for function, including the DRY motif in the ICL2 region and the NPxxY motif in TM7 . These elements are essential for G-protein activation and signal transduction.

Expression Systems and Production

Q: What are the most effective expression systems for producing functional recombinant Cottinella boulengeri Rhodopsin?

A: Based on current research methodologies, several expression systems have been employed for recombinant rhodopsin production, with E. coli being a common platform for initial characterization . When choosing an expression system, consider:

  • E. coli expression system:

    • Advantages: High yield, cost-effective, rapid production

    • Limitations: Lacks post-translational modifications, may form inclusion bodies

    • Methodology: Use of specialized strains like BL21(DE3) with T7 promoter systems

    • Buffer considerations: Tris/PBS-based buffer with 6% trehalose at pH 8.0 has been effective

  • Mammalian cell expression:

    • HEK293T cells are preferred for functional studies as they provide proper folding and post-translational modifications

    • Inducible expression systems allow controlled production

  • Insect cell expression:

    • Suitable for larger-scale production with proper folding

For experimental procedures requiring functional protein:

  • Reconstitution with chromophore is critical for activity assessment

  • Storage in glycerol (5-50%) and aliquoting for long-term storage at -20°C/-80°C prevents activity loss

  • Avoid repeated freeze-thaw cycles

The choice of expression system should be guided by the specific research question, with E. coli suitable for structural studies and mammalian systems preferred for functional analyses.

Chromophore Binding and Activation Mechanism

Q: How does 11-cis-retinal interact with recombinant rhodopsin, and what methods can be used to study the activation mechanism?

A: The interaction between 11-cis-retinal and rhodopsin is central to photoreceptor function. The chromophore binds covalently via a protonated Schiff base linkage to a conserved lysine residue (typically Lys296) in the seventh transmembrane domain .

Mechanism of interaction:

  • 11-cis-retinal fits within a binding pocket formed by the transmembrane helices

  • The Schiff base linkage is stabilized by a counterion (typically Glu113)

  • Upon light absorption, 11-cis-retinal undergoes photoisomerization to all-trans-retinal

  • This conformational change triggers structural rearrangements in the opsin protein, leading to G-protein activation

Methodological approaches to study activation:

  • Spectroscopic analysis:

    • UV-Vis spectroscopy to monitor rhodopsin's characteristic absorption maximum (~500 nm)

    • Fluorescence spectroscopy to track conformational changes

    • Circular dichroism to analyze secondary structure

  • Chromophore analogs:

    • Ring-constrained chromophores can isolate specific aspects of the activation mechanism

    • Rhodopsin regenerated with ring-constrained 11-cis-retinal analogs undergoes photoisomerization but remains marginally active

  • Time-resolved techniques:

    • Flash photolysis to capture intermediate states

    • FTIR difference spectroscopy to detect structural changes

  • Binding affinity measurements:

    • Isothermal titration calorimetry

    • Surface plasmon resonance

Recent research has demonstrated that the β-ionone ring positioning is critical for receptor activation, not merely the cis-trans isomerization itself . Studies using recombinant rhodopsin provide valuable insights into this process, with specific methodologies depending on the research question and available instrumentation.

Mutation Analysis and Disease Modeling

Q: How can recombinant rhodopsin be used to model disease-causing mutations, and what experimental approaches are most informative?

A: Recombinant rhodopsin systems provide an excellent platform for modeling disease-associated mutations, particularly those linked to retinitis pigmentosa (RP) and congenital stationary night blindness (CSNB). Experimental approaches include:

  • Deep mutational scanning (DMS):

    • Allows quantitative comparison of numerous variants simultaneously

    • HEK293T cells with inducible expression systems are optimal

    • Measures plasma membrane expression (PME) as a proxy for proper folding

    • Can assess multiple variants in the presence/absence of stabilizing compounds like 9-cis-retinal

  • Classification of mutations:

    • Class I: Can reconstitute with 11-cis-retinal to form normal rhodopsin and are transported to the cell surface

    • Class II: Localized in ER, cannot reconstitute with 11-cis-retinal or binds poorly

  • Functional characterization methods:

    • G-protein activation assays

    • Spectroscopic analysis of chromophore binding

    • Subcellular localization via confocal microscopy

    • Proteasomal degradation studies

  • Structural modeling approaches:

    • Rosetta modeling to predict changes in free energy of binding

    • Molecular dynamics simulations of variant proteins

    • Convolutional neural networks like KDEEP for predicting changes in binding energetics

Case studies of well-characterized mutations include:

The responses of different mutations to potential therapeutic compounds like 9-cis-retinal vary considerably based on the specific molecular defect, highlighting the need for precision medicine approaches .

Advanced Biophysical Characterization Techniques

Q: What are the most advanced biophysical techniques for characterizing recombinant rhodopsin structure and function?

A: Contemporary rhodopsin research employs sophisticated biophysical techniques to elucidate structure-function relationships:

  • Cryo-electron microscopy (Cryo-EM):

    • Allows visualization of rhodopsin in different conformational states

    • Can capture rhodopsin-transducin complexes

    • Sample preparation requires detergent solubilization or nanodiscs

    • Resolution can approach 3Å for well-behaved samples

  • Advanced spectroscopy:

    • Resonance Raman spectroscopy detects light-induced changes in the chromophore

    • FTIR difference spectroscopy reveals specific bond changes during activation

    • Solid-state NMR provides atomic-level details of conformational changes

  • Single-molecule techniques:

    • Fluorescence resonance energy transfer (FRET) to measure distances between domains

    • Total internal reflection fluorescence (TIRF) microscopy for membrane dynamics

    • Atomic force microscopy for topographical information

  • Cross-linking mass spectrometry (XL-MS):

    • Identifies protein-protein interaction interfaces

    • Documents conformational changes upon activation

    • Specialized fragmentation schemes and data analysis strategies enhance depth and accuracy

    • MS3-level sequencing improves confidence in cross-link identification

  • Optogenetic approaches:

    • Light-controlled activation in cellular contexts

    • Can be combined with electrophysiology for functional readouts

Each technique provides complementary information, and combining multiple approaches yields the most comprehensive understanding. For example, combining spectroscopy with cross-linking and computational modeling can reveal how conformational changes propagate through the protein structure during photoactivation.

Rhodopsin Stability and Storage Conditions

Q: What conditions optimize stability for recombinant rhodopsin during purification and storage, and how can stability be measured?

A: Maintaining rhodopsin stability is crucial for experimental reliability. Optimal conditions include:

  • Purification considerations:

    • Mild detergents (DDM, LMNG) preserve native structure

    • Buffer composition: typically Tris or phosphate-based, pH 6.5-8.0

    • Include 6% trehalose as a stabilizing agent

    • Conduct purification steps under dim red light to prevent photoactivation

  • Storage recommendations:

    • Store at -20°C/-80°C with aliquoting to minimize freeze-thaw cycles

    • Add glycerol (5-50% final concentration) as a cryoprotectant

    • Lyophilization with appropriate excipients is viable for long-term storage

  • Stability assessment methods:

    • Thermal shift assays to determine melting temperature

    • Circular dichroism to monitor secondary structure retention

    • Size-exclusion chromatography to detect aggregation

    • Functional assays (ligand binding, G-protein activation)

  • Reconstitution protocols:

    • Rehydrate lyophilized protein in deionized sterile water

    • Target concentration: 0.1-1.0 mg/mL

    • Brief centrifugation prior to opening vials ensures material collection

Stability is significantly enhanced by reconstitution with 11-cis-retinal or 9-cis-retinal prior to storage, as the chromophore provides structural stability to the protein . For experiments requiring photoactivation, all preparation steps should be conducted under dim red light (>650 nm) to prevent premature activation.

Pharmacological Tools for Rhodopsin Research

Q: What pharmacological tools are available for studying recombinant rhodopsin function, and how are they applied in research settings?

A: Several pharmacological tools enable detailed investigation of rhodopsin function:

  • Retinal analogs:

    • 9-cis-retinal: Photostable isomer used to stabilize and rescue mutant rhodopsins

    • 11-cis-locked analogs: Prevent isomerization to study activation constraints

    • Ring-constrained retinals: Isolate specific conformational changes during activation

    • All-trans-retinol: Binds preferentially to certain proteins in the visual cycle

  • Small molecule modulators:

    • YC-001: Novel non-retinoid pharmacological chaperone

      • Exhibits micromolar potency with lower cytotoxicity than 9-cis-retinal

      • Rescues multiple rhodopsin mutants including P23H, G106R, D190N, and P267L

      • Antagonizes opsin signaling in a non-competitive manner

  • Application methodologies:

    • Ligand titration: Determine binding constants and stoichiometry

    • Competition assays: Evaluate binding site specificity

    • Photobleaching studies: Assess chromophore stability and regeneration rates

    • Rescue experiments: Measure efficacy in restoring function to mutant proteins

  • Considerations for experimental design:

    • Light conditions must be controlled (dark or dim red light)

    • Vehicle controls are essential (DMSO, ethanol are common solvents)

    • Concentration ranges should span at least two orders of magnitude

    • Time-dependent effects should be monitored (acute vs. chronic exposure)

These tools provide valuable insights into rhodopsin structure-function relationships and potential therapeutic approaches for rhodopsin-associated diseases.

Photochemical Properties and Light-Induced Damage

Q: How does light exposure affect recombinant rhodopsin stability, and what methods can assess photochemical damage?

A: Rhodopsin is inherently susceptible to light-induced changes that can range from functional activation to irreversible damage:

  • Photochemical reactions in rhodopsin:

    • Absorption of photons triggers isomerization of 11-cis-retinal to all-trans-retinal

    • Photoreversal of bleaching can occur with deep blue light (403 ± 10 nm)

    • Blue light exposure causes more severe retinal damage than green light (550 ± 10 nm)

  • Mechanisms of light-induced damage:

    • Photooxidation of the chromophore and surrounding amino acids

    • Protein misfolding following repeated photobleaching

    • Formation of toxic retinal adducts

    • Activation of stress pathways, including AP-1 transcription factor

  • Assessment methodologies:

    • Spectroscopic monitoring of absorption maxima shifts

    • SDS-PAGE analysis of protein integrity post-illumination

    • Functional assays (G-protein activation) after controlled light exposure

    • Immunoblotting for stress response markers

  • Experimental design considerations:

    • Wavelength: Different spectral regions affect rhodopsin differently

    • Intensity: Should be calibrated and reported in standardized units

    • Duration: Both acute high-intensity and chronic low-intensity protocols are informative

    • Temperature: Influences rate of chemical reactions following photoactivation

Recent studies have shown that rhodopsin's susceptibility to blue light damage is significantly higher than to green light, likely due to photoreversal of bleaching being faster than metabolic regeneration . These findings have implications for both experimental design and understanding retinal degeneration mechanisms.

Computational Modeling and Simulation Approaches

Q: What computational approaches can complement experimental studies of recombinant rhodopsin, and what insights have they provided?

A: Computational methods offer powerful complementary approaches to experimental rhodopsin research:

  • Molecular dynamics (MD) simulations:

    • Reveal conformational changes during activation

    • Identify water molecules and ion movements critical for function

    • Typical simulation systems include rhodopsin embedded in lipid bilayers

    • Time scales range from nanoseconds to microseconds

  • Homology modeling and structure prediction:

    • Generate models of Cottinella boulengeri rhodopsin based on other solved structures

    • Predict effects of mutations on protein stability and function

    • Docking studies to evaluate ligand binding energetics

  • Machine learning approaches:

    • Convolutional neural networks like KDEEP predict changes in binding free energy

    • Can rapidly screen effects of mutations without experimental testing

    • Models trained on protein-ligand complexes achieve high accuracy for stability predictions

  • Quantitative structure-activity relationship (QSAR) models:

    • Correlate molecular features with functional outcomes

    • Guide design of new chromophore analogs

    • Predict efficacy of pharmacological chaperones

  • Methodology for computational studies:

    • Force fields: CHARMM36, AMBER, and OPLS are commonly used

    • Solvent models: Explicit (TIP3P, SPC/E) vs. implicit representations

    • Analysis tools: Principal component analysis, network analysis, and free energy calculations

Recent computational studies have revealed that many disease-causing mutations compromise stability rather than directly disrupting retinal binding, suggesting therapeutic approaches focused on protein stabilization . These computational insights have guided experimental design and interpretation of functional studies.

Recombinant Rhodopsin in Optogenetic Applications

Q: How can recombinant rhodopsin be adapted for optogenetic applications, and what modifications enhance its utility?

A: Recombinant rhodopsin has emerged as a valuable optogenetic tool, with several adaptations enhancing its utility:

  • Engineering modifications for optogenetic applications:

    • Spectral tuning through targeted mutations in the chromophore binding pocket

    • Kinetic modifications to alter activation/deactivation rates

    • Trafficking signal addition for improved membrane localization

    • Fusion with fluorescent proteins for visualization

  • Bidirectional optogenetic control systems:

    • eNPAC2.0 (NpHR-TS-p2A-hChR2(H134R)-EYFP) allows both activation and inhibition

    • BiPOLES combines blue-light-activated GtACR2 and red-light-activated Chrimson

    • Enables simultaneous control of neuronal activity with different wavelengths

  • Signaling/enzyme rhodopsins:

    • Eight-transmembrane (8-TM) proteins with both N and C termini on cytoplasmic side

    • Include histidine kinase rhodopsin (HKR), guanylate cyclase (Rh-GC), and rhodopsin phosphodiesterase (Rh-PDE)

    • Allow light-controlled enzymatic activities in cellular contexts

  • Methodology for implementation:

    • Viral vector delivery systems (AAV, lentivirus)

    • Cell-type specific promoters for targeted expression

    • Illumination protocols optimized for activation wavelength and kinetics

    • Combined electrophysiological recording for functional validation

  • Performance metrics:

    • Temporal precision (millisecond timescale)

    • Light sensitivity (activation threshold)

    • Spectral specificity (activation wavelength range)

    • Reversibility and repeatability of activation

These adaptations have expanded the rhodopsin toolkit beyond visual research, enabling precise control of cellular activity in neuroscience and cell biology applications.

Analytical Methods for Rhodopsin Quality Assessment

Q: What analytical methods provide the most comprehensive assessment of recombinant rhodopsin quality and functionality?

A: A multi-faceted analytical approach ensures recombinant rhodopsin quality:

  • Purity assessment:

    • SDS-PAGE with Coomassie or silver staining (target >90% purity)

    • Size-exclusion chromatography to detect aggregates

    • Mass spectrometry for molecular weight confirmation and post-translational modification analysis

  • Functional characterization:

    • UV-visible spectroscopy:

      • A280/A500 ratio (ideally 1.6-1.8 for properly folded rhodopsin)

      • Characteristic absorption maximum (~500 nm for bovine rhodopsin)

      • Spectral shift upon photobleaching

    • G-protein activation assays:

      • GTPγS binding

      • Bioluminescence resonance energy transfer (BRET)

  • Structural integrity analysis:

    • Circular dichroism to confirm α-helical content

    • Thermal stability assays (melting temperature determination)

    • Limited proteolysis to probe folding quality

    • Intrinsic tryptophan fluorescence for tertiary structure assessment

  • Chromophore binding analysis:

    • Retinal binding kinetics using stopped-flow spectroscopy

    • Regeneration rate with exogenous chromophore

    • Meta II decay rate measurement

    • Chromophore extraction and HPLC analysis

  • Data integration and reporting standards:

    • Minimum quality criteria: >90% purity, >80% spectral A280/A500 ratio

    • Activity benchmarking against reference standards

    • Stability profiles under various storage conditions

    • Batch-to-batch consistency metrics

For mutation studies, a standardized approach comparing plasma membrane expression in the presence and absence of stabilizing cofactors allows quantitative assessment of variant functionality and response to potential therapeutic compounds .

Visual Cycle and Rhodopsin Regeneration

Q: What are the mechanisms of rhodopsin regeneration, and how can they be studied in recombinant systems?

A: Rhodopsin regeneration involves complex biochemical pathways that can be modeled in recombinant systems:

  • Visual cycle components:

    • All-trans-retinal released after photoactivation

    • Conversion to vitamin A (all-trans-retinol)

    • Transport to retinal pigment cells

    • Conversion to 11-cis-retinal

    • Return to photoreceptors and regeneration of rhodopsin

  • Key proteins involved:

    • PINTA: Retinoid-binding protein required for rhodopsin formation

      • Binds preferentially to all-trans-retinol

      • Required subsequent to formation of vitamin A

      • Functions in retinal pigment cells

    • RPE65: Isomerohydrolase converting all-trans-retinyl esters to 11-cis-retinol

    • LRAT: Lecithin retinol acyltransferase

    • CRALBP: Cellular retinaldehyde-binding protein

  • Experimental approaches:

    • In vitro regeneration assays with purified proteins

    • Cell-based systems expressing visual cycle components

    • Isotope labeling to track retinoid movement

    • Genetic knockouts to assess protein contributions

  • Methodological considerations:

    • Dark adaptation prior to experiments

    • Controlled photobleaching protocols

    • Time-resolved spectroscopy to monitor intermediate states

    • Extraction and HPLC analysis of retinoids

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.