Recombinant Cottocomephorus grewingki Rhodopsin (rho)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Cottocomephorus grewingki Rhodopsin (rho)

Recombinant Cottocomephorus grewingki rhodopsin (rho) is a transmembrane protein produced via E. coli expression systems. This recombinant form of rhodopsin is derived from the Baikal yellowfin (Cottocomephorus grewingkii), a fish species adapted to cold environments. The protein retains structural and functional features critical for studying G-protein-coupled receptor (GPCR) dynamics, particularly in photoreceptor biology and retinal degeneration research. Below is a detailed analysis of its characteristics, production, and research applications.

Primary Sequence and Domains

The recombinant protein spans residues 1–289 of the full-length rhodopsin sequence, including conserved motifs essential for ligand binding and G-protein interaction. Key structural elements include:

  • N-terminal His-tag: Facilitates purification via affinity chromatography.

  • Seven transmembrane helices (7TM): Form the core architecture for retinal binding and signal transduction.

  • Retinal-binding site: A lysine residue (K296) covalently linked to 11-cis-retinal via a Schiff base, critical for photon absorption and activation .

Table 3: Key Research Insights from Rhodopsin Studies

MechanismImpact on PhotoreceptorsExample Mutations
Misfolding/ER StressAccumulation of misfolded opsin triggers apoptosisP23H, R135L
Constitutive ActivationPersistent G-protein signaling causes photoreceptor deathK296E, G188R
Oxidative StressImpaired mitochondrial function accelerates cell deathR135L, G188R

Product Specs

Form
Lyophilized powder

Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes. We will accommodate requests whenever possible.

Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.

Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.

Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a useful guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and inherent protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.

Tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.

Synonyms
rho; Rhodopsin; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-289
Protein Length
full length protein
Species
Cottocomephorus grewingkii (Baikal yellowfin) (Cottus grewingkii)
Target Names
rho
Target Protein Sequence
YLVNPAAYAAPGAYMFLLILVGFPVNFLTLYVTLEHKKLRTPLNYILLNLAVADLFMVLG GFTTTMYTSMHGYFVLGRLGCNLEGFFATLGGEIALWSLVVLAIERWIVVCKPISNFRFT EDHAIMGLAFSWVMALTCAVPPLVGWSRYIPEGMQCSCGVDYYTRAEGFNNESFVIYMFI VHFLIPLSNNFFCYGRLLCAVKEAAAAQQESETTQRAEREVSRMVVMMVVSFLMCWLPYA SVAWYIFCNQGSEFGPIFMTLPAFFAKSSAIYNPLIYICMNKHVRHCMI
Uniprot No.

Target Background

Function

A photoreceptor essential for low-light vision. While most saltwater fish utilize retinal as a chromophore, most freshwater species employ 3-dehydroretinal, or a combination of both. Light-induced isomerization of 11-cis to all-trans retinal triggers a conformational change, activating signaling through G-proteins. Subsequent receptor phosphorylation, mediated by arrestin, displaces the bound G-protein alpha subunit, terminating the signaling cascade.

Protein Families
G-protein coupled receptor 1 family, Opsin subfamily
Subcellular Location
Membrane; Multi-pass membrane protein. Cell projection, cilium, photoreceptor outer segment.

Q&A

What is Cottocomephorus grewingki Rhodopsin and why is it significant for research?

Cottocomephorus grewingki Rhodopsin (rho) is a photoreceptive membrane protein from Baikal yellowfin (also known as Cottus grewingkii), a cottoid fish species endemic to Lake Baikal in Eastern Siberia . This rhodopsin belongs to a family of proteins that function as light-sensitive receptors in the visual system. The significance of this particular rhodopsin stems from its evolutionary context within the adaptive radiation of cottoid fishes in Lake Baikal, which represents a valuable model for studying visual adaptation to unique ecological niches. The protein has been characterized as a full-length transmembrane protein with the UniProt accession number O42328 . It serves as an important subject for comparative studies of spectral tuning mechanisms and evolutionary adaptations in visual systems. Research with this protein contributes to both fundamental understanding of protein structure-function relationships and potential applications in optogenetics where rhodopsins are used as molecular tools for light-controlled manipulation of cellular activity .

How does Cottocomephorus grewingki Rhodopsin compare structurally to other fish rhodopsins?

Comparative structural analysis of Cottocomephorus grewingki Rhodopsin with other fish rhodopsins reveals both conserved elements and unique adaptations that reflect evolutionary specialization. Lake Baikal cottoid fishes represent a remarkable case of adaptive radiation, with different species evolving distinct visual systems adapted to various depths and light conditions . When comparing the rhodopsin sequence from C. grewingki with those of other cottoid fishes and more distantly related species like goldfish (Carassius auratus), researchers can identify regions of high conservation that maintain essential structural and functional properties across diverse lineages. These typically include residues forming the retinal binding pocket and those involved in G-protein coupling.

What are the key specifications of the recombinant form of this protein available for research?

The recombinant form of Cottocomephorus grewingki Rhodopsin available for research has several important specifications that researchers should consider when designing experiments:

CharacteristicDescription
Product CodeCSB-CF019681DXH
Protein TypeTransmembrane Protein
Expression Systemin vitro E. coli expression system
Expression Region1-289 (full length protein)
Tag InformationN-terminal 10xHis-tagged
Storage RequirementsStore at -20°C; for extended storage, -20°C or -80°C
Shelf LifeLiquid form: 6 months at -20°C/-80°C; Lyophilized form: 12 months

The recombinant protein is expressed with an N-terminal histidine tag, which facilitates purification using metal affinity chromatography but should be considered when interpreting functional data as it may influence certain protein properties . The protein is produced in an E. coli expression system, meaning it lacks eukaryotic post-translational modifications. For working aliquots, storage at 4°C for up to one week is recommended, but repeated freezing and thawing should be avoided to maintain protein integrity . The shelf life varies depending on storage conditions, with the lyophilized form offering greater stability for long-term storage. These specifications provide essential information for researchers planning experiments with this recombinant protein, ensuring optimal handling and experimental outcomes.

What expression systems are optimal for producing functional Cottocomephorus grewingki Rhodopsin?

The optimal expression of functional Cottocomephorus grewingki Rhodopsin requires careful consideration of expression systems and conditions. While the commercially available recombinant protein is produced in an E. coli expression system , researchers developing their own expression protocols should consider several factors to maximize yield and functionality. Bacterial expression systems, particularly E. coli, offer advantages of simplicity, scalability, and cost-effectiveness, making them suitable for initial studies. When using E. coli systems, supplementation with all-trans retinal (typically 10 μM) during expression is essential for proper folding and chromophore incorporation . The expression temperature should be optimized, with lower temperatures (16-25°C) often improving proper folding of membrane proteins.

For more advanced studies requiring native-like post-translational modifications or higher expression levels, mammalian expression systems may be preferred. The 293T cell line has been successfully used for expressing fish opsins in previous studies . This approach may yield protein with more native-like properties but requires more complex protocols and resources. Regardless of the expression system chosen, verification of protein expression through western blotting using anti-His antibodies (detecting the N-terminal His tag) and assessment of chromophore incorporation through absorption spectroscopy are essential quality control steps to ensure the production of functional protein.

What are the recommended protocols for purification and storage to maintain protein stability?

Purification and storage of Cottocomephorus grewingki Rhodopsin require specific protocols to maintain structural integrity and function. For purification, the N-terminal 10xHis-tag facilitates isolation using immobilized metal affinity chromatography (IMAC) . Following initial purification, additional chromatography steps (such as size exclusion) may be necessary to achieve high purity. Throughout the purification process, it is crucial to maintain the protein in detergent-containing buffers to preserve the native structure of this transmembrane protein.

For storage, several considerations are essential to maintain stability. The recommended storage temperature is -20°C for routine use, with -20°C or -80°C advised for extended storage periods . The physical state of the protein significantly impacts stability, with lyophilized preparations offering extended shelf life (up to 12 months) compared to liquid formulations (approximately 6 months). Working aliquots can be stored at 4°C for up to one week, but repeated freezing and thawing should be strictly avoided as it compromises protein integrity . Buffer composition should include appropriate detergents, stabilizing agents like glycerol, and potentially reducing agents to prevent oxidation. The protein should be protected from light during storage and handling to prevent photobleaching. By adhering to these purification and storage recommendations, researchers can maximize the functional lifespan of their Cottocomephorus grewingki Rhodopsin preparations.

How can researchers verify successful expression and functional integrity of the recombinant protein?

Verifying the successful expression and functional integrity of recombinant Cottocomephorus grewingki Rhodopsin requires a multi-faceted approach combining biochemical, spectroscopic, and functional analyses. Initially, SDS-PAGE analysis should be performed to confirm the presence of a protein band at the expected molecular weight (approximately 35-40 kDa), followed by western blotting using anti-His antibodies to specifically identify the His-tagged recombinant protein .

The hallmark of functional rhodopsin is its ability to bind retinal and form a light-sensitive chromophore. This can be assessed through UV-visible absorption spectroscopy, where properly folded rhodopsin will exhibit a characteristic absorption peak typically between 480-530 nm, depending on the specific protein. A critical verification method involves bleaching experiments with hydroxylamine, which hydrolyzes the retinal-protein bond in properly folded rhodopsin, resulting in a characteristic shift in the absorption spectrum . This technique allows quantification of the fraction of correctly folded, functional protein in the preparation.

For more comprehensive functional assessment, researchers can reconstitute the purified rhodopsin with 11-cis retinal following established protocols that include solubilization of the protein in appropriate detergent-containing buffers, binding to an affinity column, and elution of the purified pigment . Subsequent spectrophotometric analysis of the reconstituted protein provides definitive evidence of functional integrity. For rhodopsins with ion-pumping activity, additional functional assays in reconstituted proteoliposomes can verify the protein's capability to transport ions in response to light stimulation, providing the most direct evidence of functional integrity.

What methodologies are most effective for studying spectral tuning in Cottocomephorus grewingki Rhodopsin?

Spectral tuning studies of Cottocomephorus grewingki Rhodopsin require a systematic approach combining molecular biology techniques with spectroscopic analyses. An effective methodology begins with establishing the baseline spectral properties of the wild-type protein through UV-visible spectroscopy, determining its wavelength of maximum absorption (λmax). This serves as the reference point for comparative studies. The bleaching technique using hydroxylamine provides a reliable method for measuring absorption spectra, as it causes hydrolysis of the retinal-protein bond and generates a characteristic spectral shift .

Site-directed mutagenesis represents the core experimental approach for investigating spectral tuning mechanisms. Strategic selection of target residues should be guided by comparative sequence analysis with other cottoid fish rhodopsins, structural modeling to identify residues near the retinal binding pocket, and knowledge of known spectral tuning sites from literature . Once mutants are generated, they should be expressed under identical conditions as the wild-type protein to ensure fair comparisons. Spectral analysis of purified mutant proteins allows researchers to quantify "red-shift gains" or "blue-shift losses" relative to the wild-type protein .

Machine learning approaches can significantly enhance spectral tuning studies by predicting potentially important residues and optimizing experimental design. This data-driven approach has demonstrated success in identifying rhodopsins with red-shifted absorption properties with high accuracy (82%) . By combining traditional site-directed mutagenesis with computational prediction methods, researchers can efficiently navigate the vast sequence space and identify key determinants of spectral properties in Cottocomephorus grewingki Rhodopsin.

How can site-directed mutagenesis be used to investigate structure-function relationships in this protein?

Site-directed mutagenesis represents a powerful approach for investigating structure-function relationships in Cottocomephorus grewingki Rhodopsin. Two effective mutagenesis protocols have been documented for fish opsins: the Promega Altered Sites® II system and the Stratagene QuikChange™ system . The process begins with strategic selection of mutation targets based on sequence comparison between species with different absorption maxima, structural modeling to identify residues near the chromophore, and literature data on known functional sites.

For the QuikChange™ approach, researchers design mutagenic oligonucleotide primers containing the desired mutation, perform PCR with high-fidelity polymerase, digest the parent template with DpnI, and transform the product into competent cells . Following mutagenesis, it is essential to sequence the entire coding region to confirm the desired mutation and check for any unintended secondary mutations. Verified mutant sequences are then cloned into an appropriate expression vector (such as pMT4) for functional characterization .

Expression and functional analysis involves transfection into mammalian cells (e.g., 293T cells), verification of expression by Western blotting, and reconstitution with 11-cis retinal for spectral analysis . The systematic comparison of spectral, biochemical, and functional properties between wild-type and mutant proteins allows researchers to establish structure-function correlations. This approach enables the identification of key residues involved in chromophore binding, spectral tuning, and signal transduction, providing insights into both the molecular mechanisms underlying rhodopsin function and the evolutionary adaptations that have shaped its properties in Cottocomephorus grewingki.

What techniques are available for reconstituting Cottocomephorus grewingki Rhodopsin with retinal for functional studies?

Reconstitution of Cottocomephorus grewingki Rhodopsin with retinal is a critical step for functional studies, particularly for spectral characterization. The process involves several key steps that have been established through studies on fish rhodopsins. The first stage is the preparation of 11-cis retinal, which serves as the chromophore that confers light sensitivity to the protein . This can be obtained commercially or prepared in the laboratory under conditions that protect this light-sensitive molecule from isomerization.

The reconstitution protocol begins with solubilization of the expressed protein in an appropriate detergent-containing buffer. The solubilized protein is then bound to an affinity column (such as a 1D4 antibody column for rhodopsins with the corresponding epitope, or a nickel column for His-tagged proteins) . After washing to remove unbound material, the protein is mixed with 11-cis retinal under conditions that promote chromophore binding. Following incubation, the reconstituted visual pigment is eluted from the column and immediately subjected to spectrophotometric analysis .

The success of reconstitution can be verified through UV-visible absorption spectroscopy, where properly reconstituted rhodopsin will exhibit a characteristic absorption peak. The functionality of the reconstituted protein can be further confirmed through bleaching experiments with hydroxylamine, which causes hydrolysis of the retinal-protein bond and results in a characteristic spectral shift . For more comprehensive functional characterization, additional assays such as G-protein activation (for visual rhodopsins) or ion transport measurements (for ion-pumping rhodopsins) can be performed with the reconstituted protein.

How does Cottocomephorus grewingki Rhodopsin contribute to understanding evolutionary adaptations in Lake Baikal fishes?

Cottocomephorus grewingki Rhodopsin serves as a valuable model for understanding evolutionary adaptations in sensory systems, particularly in the context of the adaptive radiation of cottoid fishes in Lake Baikal. This ancient lake, with its diverse habitats ranging from shallow shorelines to depths exceeding 1,600 meters, has driven the evolution of specialized visual systems adapted to different light environments . The study of C. grewingki rhodopsin provides insights into how visual pigments adapt to specific ecological niches through molecular evolution.

Comparative analysis of rhodopsin sequences across different cottoid fish species from Lake Baikal reveals patterns of amino acid substitutions that correlate with habitat depth and light conditions. These molecular changes often concentrate in regions that influence spectral sensitivity, suggesting adaptive evolution in response to the available light spectrum at different depths . The molecular phylogenetic analysis of these visual pigments helps reconstruct the evolutionary history of Baikal fishes, providing evidence for the timing and pattern of species divergence.

Research methodologies for studying these evolutionary adaptations include sequence-based phylogenetic analysis, ancestral sequence reconstruction, and experimental verification of functional consequences through heterologous expression and spectral characterization . The integration of molecular data with ecological information about species distribution and habitat light conditions provides a comprehensive understanding of how natural selection has shaped visual systems in these fishes. This research contributes to fundamental questions in evolutionary biology about sensory adaptation to novel environments and offers insights into the molecular mechanisms underlying phenotypic evolution.

What potential applications exist for Cottocomephorus grewingki Rhodopsin in optogenetics research?

Cottocomephorus grewingki Rhodopsin holds significant potential for optogenetics research, where photoreceptive proteins are used as molecular tools to control cellular activity with light. Microbial rhodopsins have become essential components of the optogenetic toolkit, allowing precise temporal and spatial control of neural activity . The unique properties of C. grewingki rhodopsin, adapted to the specific light environment of Lake Baikal, may offer advantages for particular optogenetic applications.

One promising direction involves the investigation of spectral tuning mechanisms in C. grewingki rhodopsin to develop variants with red-shifted absorption properties. Red-shifted rhodopsins are particularly valuable for in vivo applications, as longer wavelength light penetrates tissue more effectively with less scattering and absorption . Understanding the natural molecular adaptations in this rhodopsin could inform the rational design of improved optogenetic tools with desired spectral properties.

Machine learning-based approaches have demonstrated success in identifying red-shifted rhodopsins, with an 82% accuracy rate in predicting proteins with red-shift gains . Applying similar methodologies to C. grewingki rhodopsin and related proteins could accelerate the development of novel optogenetic tools. The experimental verification of spectral properties involves expression in appropriate systems (such as E. coli or mammalian cells), purification, and spectral characterization through UV-visible absorption spectroscopy, particularly using the hydroxylamine bleaching technique to quantify absorption maxima . Through these approaches, C. grewingki rhodopsin could contribute to expanding the optogenetic toolkit, enabling more sophisticated manipulation of biological systems with light.

How can machine learning approaches enhance research on Cottocomephorus grewingki Rhodopsin?

Machine learning (ML) approaches offer powerful tools for advancing research on Cottocomephorus grewingki Rhodopsin, particularly in predicting functional properties and optimizing experimental design. A significant application involves the prediction of spectral tuning effects from amino acid sequences. ML models trained on existing datasets of rhodopsin sequences and their absorption maxima can identify patterns and correlations that may not be apparent through conventional analysis . These models can predict how specific amino acid substitutions will affect the wavelength of maximum absorption, guiding the design of site-directed mutagenesis experiments.

Bayesian experimental design methods represent a particularly valuable ML approach for rhodopsin research. This methodology has demonstrated remarkable success in screening rhodopsins for red-shifted absorption properties, achieving an 82% accuracy rate in identifying proteins with red-shift gains . By applying similar approaches to C. grewingki rhodopsin, researchers can efficiently explore the vast sequence space and identify variants with desired properties, such as red-shifted absorption or enhanced stability.

The implementation of ML-based research on C. grewingki rhodopsin involves several steps: compiling diverse datasets of rhodopsin sequences with known spectral properties, extracting relevant sequence and structural features, training predictive models, validating predictions through experimental testing, and iteratively refining the models with new data . This iterative process creates a virtuous cycle of improvement, where experimental results inform model refinement, and improved models guide more effective experiments. This data-driven approach can significantly accelerate the pace of discovery in rhodopsin research, leading to both fundamental insights into protein structure-function relationships and practical applications in fields such as optogenetics.

What are common challenges in working with Cottocomephorus grewingki Rhodopsin and how can they be addressed?

Working with Cottocomephorus grewingki Rhodopsin presents several challenges that researchers should anticipate and address through strategic experimental design. One common challenge is achieving adequate expression levels of properly folded protein. This can be addressed by optimizing expression conditions, including lowering the induction temperature (16-20°C), extending cultivation time after induction, and supplementing growth media with all-trans retinal (10 μM) to promote proper folding . Selecting appropriate E. coli strains specialized for membrane protein expression can also improve yields.

Protein stability represents another significant challenge, as rhodopsins are prone to denaturation during purification and storage. To maintain stability, researchers should use appropriate detergents for solubilization, avoid repeated freeze-thaw cycles, and store the protein at recommended temperatures (-20°C or -80°C for extended storage) . For working samples, storage at 4°C is acceptable for up to one week, but longer-term storage requires freezing or lyophilization . The lyophilized form offers extended shelf life (up to 12 months) compared to liquid formulations (approximately 6 months) .

Spectral analysis challenges include inconsistent absorption spectra and high background noise. These issues can be addressed by standardizing protein concentration for all measurements, ensuring complete reconstitution with retinal, controlling pH precisely, and implementing background subtraction techniques. For bleaching experiments, optimizing hydroxylamine concentration (typically 100 mM) and ensuring complete light exposure are essential for accurate quantification of functional rhodopsin . By anticipating these challenges and implementing appropriate methodological solutions, researchers can enhance the reliability and reproducibility of their work with C. grewingki rhodopsin.

What factors should be considered when designing experiments to investigate spectral tuning mechanisms?

Designing effective experiments to investigate spectral tuning mechanisms in Cottocomephorus grewingki Rhodopsin requires careful consideration of multiple factors. Target selection represents a critical first step, focusing on residues likely involved in spectral tuning based on sequence comparison, structural modeling, and literature data . Priority should be given to residues in or near the retinal binding pocket and positions that differ between species with different absorption maxima.

Mutation design should follow a strategic approach, beginning with conservative mutations (maintaining similar physicochemical properties) and including reciprocal mutations between different species' variants to test directional effects. Combinatorial mutations can reveal synergistic effects that might not be apparent from single substitutions. A well-designed experimental plan should include appropriate controls, such as wild-type protein expressed under identical conditions and neutral mutations outside the retinal pocket as negative controls .

The expression system significantly impacts experimental outcomes. While E. coli systems offer simplicity and cost-effectiveness, mammalian expression systems may provide more native-like protein folding and post-translational modifications . Regardless of the system chosen, consistent expression conditions are essential for fair comparisons between variants. Data analysis should establish quantitative criteria for significant spectral shifts, control for experimental variables such as pH and temperature, and develop structure-based models to explain observed effects. Through this systematic approach, researchers can generate reliable and interpretable data about the molecular mechanisms of spectral tuning in C. grewingki rhodopsin.

How should researchers interpret and validate conflicting data when studying this protein?

When encountering conflicting data in studies of Cottocomephorus grewingki Rhodopsin, researchers should implement a systematic approach to interpretation and validation. The first step involves critically evaluating experimental methodologies to identify potential sources of variation. Differences in expression systems, purification protocols, buffer compositions, or measurement conditions can significantly impact results, particularly for sensitive properties like spectral absorption maxima.

Reproducibility testing represents a cornerstone of data validation. Researchers should repeat critical experiments with independent protein preparations, ideally using different experimental approaches to measure the same parameter. For spectral analysis, this might involve comparing results from different spectroscopic techniques or varying the conditions of the bleaching experiment to ensure robustness . Statistical analysis should be applied to distinguish significant differences from random variations, particularly when comparing closely related mutants.

External validation through comparison with existing literature on related rhodopsins provides an important context for interpreting results. While C. grewingki rhodopsin may have unique properties, its behavior should generally conform to established principles of rhodopsin structure and function. Collaboration with other research groups to independently verify key findings can strengthen confidence in controversial or unexpected results. When publishing findings, transparent reporting of all experimental conditions, raw data, and analysis methods enables other researchers to evaluate and potentially resolve conflicting results. Through this rigorous approach to data interpretation and validation, researchers can advance our understanding of C. grewingki rhodopsin despite the challenges inherent in studying this complex membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.