Recombinant Cottocomephorus inermis Rhodopsin (rho)

Shipped with Ice Packs
In Stock

Description

Definition and Structure of Recombinant Cottocomephorus inermis Rhodopsin (Rho)

Recombinant Cottocomephorus inermis rhodopsin (rho) is a synthetic version of the light-sensitive G protein-coupled receptor (GPCR) derived from the Longfin Baikal sculpin (Cottocomephorus inermis). Native rhodopsin consists of an opsin apoprotein covalently bound to 11-cis-retinal, enabling photon absorption and signal transduction in photoreceptor cells . The recombinant form is engineered in heterologous systems (e.g., yeast or E. coli) to study its structural, functional, and spectral properties .

Production and Purification

Recombinant rho is produced via heterologous expression systems, with purification strategies tailored to maintain structural integrity.

ParameterDetails
Expression HostE. coli (full-length) or yeast (partial)
TagN-terminal His-tag for affinity chromatography
Purity>85% (SDS-PAGE)
StorageLyophilized: 12 months at -20°C/-80°C; Liquid: 6 months at -20°C/-80°C

Research Applications

This recombinant protein is pivotal for studying rhodopsin’s role in visual signaling and retinal degeneration.

Functional Studies

  • Spectral Modulation: Used to investigate how cavity/extracavity amino acids alter λ<sub>max</sub> via electrostatic effects. For example, negative charges near the β-ionone ring stabilize excited states, red-shifting λ<sub>max</sub> .

  • Thermal Noise: Examines the inverse relationship between rhodopsin’s λ<sub>max</sub> and chromophore thermal isomerization rates, critical for understanding photoreceptor sensitivity .

Disease Modeling

  • Retinitis Pigmentosa (RP): Mutations in human RHO disrupt protein folding or signaling, leading to photoreceptor degeneration. C. inermis rhodopsin serves as a model to study misfolding mechanisms (e.g., Y102H, I307N mutants) .

  • Gene Therapy Testing: Assesses CRISPR/Cas9-based knock-out and replacement therapies for autosomal dominant RP, as seen in preclinical trials for RHO-related adRP .

Spectral and Biophysical Properties

PropertyValueSource
λ<sub>max</sub>~484 nm
ΔE (Excitation Energy)1.9–3.3 kcal/mol (A1/A2 chromophores)
Thermal IsomerizationInverse correlation with λ<sub>max</sub>

Conformational Dynamics

  • Inactive-Active Equilibrium: Mutations (e.g., I307N) shift equilibrium toward active states, altering transducin activation kinetics .

  • Chromophore Interactions: Hydrogen bonding at the retinal Schiff base (RSB) stabilizes ground states, while charge-transfer states dominate in excited states .

Comparison with Other Rhodopsins

FeatureC. inermis RhoHuman RhoMicrobial Rhodopsins
λ<sub>max</sub>~484 nm~498 nm480–540 nm (bacteriorhodopsin)
Structural StabilityEnhanced by cavity charges Sensitive to misfolding High thermostability (e.g., Halobacterium)
Signaling PathwayG protein activationG<sub>t</sub> activationIon pump or light-driven proton transport

Challenges and Considerations

  • Stability: Recombinant proteins require strict storage conditions to prevent aggregation or degradation .

  • Limitations: Partial-length constructs may lack full functional activity, necessitating full-length expression systems .

  • Clinical Relevance: While C. inermis rhodopsin informs RP mechanisms, human-specific mutations (e.g., P23H) require tailored therapeutic approaches .

Future Directions

  1. Gene Therapy Optimization: Leveraging CRISPR/Cas9 or RNA interference to silence toxic RHO alleles while replacing them with functional copies .

  2. Photoregulin Development: Small molecules (e.g., PR3) that suppress RHO expression in C. inermis models may translate to human RP treatments .

  3. Structural Insights: High-resolution studies of C. inermis rhodopsin’s chromophore pocket could guide rational drug design for retinal diseases .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
rho; Rhodopsin; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-289
Protein Length
full length protein
Species
Cottocomephorus inermis (Longfin Baikal sculpin)
Target Names
rho
Target Protein Sequence
YLVNPAAYAALGAYMFLLILIGFPVNFLTLYVTIEHKKLRTPLNYILLNLAVANLFMVLG GFTTTMYTSMHGYFVLGRLGCNLEGFFATMGGEIALWSLVVLAIERWIVVCKPISNFRFT EDHAIMGLAFTWVMALSCAVPPLVGWSRYIPEGMQCSCGVDYYTRAEGFNNESFVIYMFI VHFLTPLIIISFCYGRLLCAVKEAAAAQQESETTQRAEREVSRMVVMMVISFLMCWLPYA SVAWYIFCNQGSEFGPIFMTLPAFFAKSSAIYNPLIYICMNKQFRHCMI
Uniprot No.

Target Background

Function

Recombinant Cottocomephorus inermis Rhodopsin (rho) is a photoreceptor essential for low-light vision. While most marine fish utilize retinal as a chromophore, freshwater fish often utilize 3-dehydroretinal, or a mixture of both. Light-induced isomerization of 11-cis to all-trans retinal initiates a conformational change, activating signaling via G-proteins. Subsequent receptor phosphorylation, mediated by arrestin, displaces the bound G-protein alpha subunit, terminating the signaling cascade.

Protein Families
G-protein coupled receptor 1 family, Opsin subfamily
Subcellular Location
Membrane; Multi-pass membrane protein. Cell projection, cilium, photoreceptor outer segment.

Q&A

What is Cottocomephorus inermis rhodopsin and why is it studied?

Cottocomephorus inermis rhodopsin is a photosensitive G protein-coupled receptor (GPCR) found in the Longfin Baikal sculpin, a fish species native to Lake Baikal. This rhodopsin functions as a visual pigment responsible for light detection in the fish's retina. The full-length protein consists of 289 amino acids with UniProt ID O42330 and contains the characteristic seven transmembrane α-helical structure common to type II rhodopsins .

Researchers study this particular rhodopsin because:

  • It represents an evolutionary adaptation to the unique light conditions of Lake Baikal

  • It serves as a comparative model for understanding rhodopsin diversity across aquatic vertebrates

  • Its structural and functional properties may reveal insights into visual adaptation in deep-water environments

How does animal rhodopsin structure relate to its function?

Animal rhodopsins like that from C. inermis function as G protein-coupled receptors with a distinctive structure-function relationship:

The protein structure consists of seven transmembrane α-helices with the chromophore, retinal, covalently bound to a lysine residue (typically Lys296 in bovine rhodopsin) in the seventh helix through a Schiff base linkage . This structural arrangement allows the protein to:

  • Maintain 11-cis retinal in the dark inactive state under physiological conditions

  • Undergo rapid photoisomerization to all-trans retinal upon light absorption

  • Trigger conformational changes that activate G protein signaling pathways

  • Progress through distinct photointermediates (Photo, Batho, Lumi, MetaI, and MetaII)

The salt bridge between the protonated Schiff base and a negatively charged counterion (Glu113 in bovine rhodopsin) suppresses constitutive activity in the dark state . This precise structural arrangement enables the protein to function as a molecular switch, converting photon energy into biochemical signals with high efficiency.

What distinguishes animal rhodopsins from microbial rhodopsins?

While both animal and microbial rhodopsins share some common features, they represent a fascinating case of convergent evolution with distinct characteristics:

FeatureAnimal Rhodopsins (Type II)Microbial Rhodopsins (Type I)
Organism distributionFound in animalsFound in prokaryotes and eukaryotic microbes
Primary functionG protein-coupled receptors for visionIon transporters and phototaxis sensors
Retinal isomer (dark state)11-cis retinalAll-trans retinal
Photoisomerization11-cis to all-transAll-trans to 13-cis
Sequence homologyNo detectable sequence similarity between typesNo detectable sequence similarity between types
StructureSeven transmembrane α-helicesSeven transmembrane α-helices
Schiff basePresent in both, connecting retinal to a lysinePresent in both, connecting retinal to a lysine

Despite their structural similarities, these proteins have independently evolved to bind retinal chromophores and respond to light, with distinct molecular and physiological functions appropriate to their respective organisms .

What expression systems are optimal for producing recombinant C. inermis rhodopsin?

The expression of functional rhodopsin presents several challenges due to its membrane protein nature and requirement for proper folding and chromophore binding. Based on available data:

Expression SystemAdvantagesConsiderations
E. coli- Rapid growth
- High protein yield
- Well-established protocols
- Lower cost
- May lack proper post-translational modifications
- Inclusion bodies may form
- Requires refolding strategies
Insect cells- Better membrane protein folding
- More natural post-translational modifications
- More complex culture conditions
- Higher cost
- Longer expression time
Mammalian cells- Native-like membrane environment
- Complete post-translational modifications
- Most expensive option
- Lower yields
- Technically demanding

For optimal expression in E. coli:

  • Use specialized strains like C41(DE3) or C43(DE3) designed for membrane proteins

  • Optimize induction conditions (temperature, IPTG concentration, induction time)

  • Consider fusion partners that enhance solubility

  • Add retinal during expression to promote proper folding

The choice of expression system should align with research objectives—E. coli for structural studies requiring high protein quantities, mammalian cells for functional studies requiring native-like protein.

What purification strategies yield the highest purity and activity of recombinant rhodopsin?

Purifying functional rhodopsin requires careful consideration of detergent selection and chromatography techniques:

Recommended purification workflow:

  • Membrane preparation:

    • Isolate membrane fractions containing the recombinant rhodopsin

    • Wash membranes to remove peripheral proteins

  • Solubilization:

    • Use mild detergents to extract rhodopsin while preserving structure

    • Common detergents include n-dodecyl-β-D-maltoside (DDM), n-octyl-β-D-glucoside (OG), or digitonin

    • Conduct solubilization in darkness or under dim red light to prevent photobleaching

  • Affinity chromatography:

    • For His-tagged C. inermis rhodopsin, use immobilized metal affinity chromatography (IMAC)

    • Include appropriate detergent in all buffers to maintain protein solubility

    • Consider adding glycerol (6-10%) to enhance stability

  • Size exclusion chromatography (SEC):

    • Further purify the protein and remove aggregates

    • Assess monodispersity and oligomeric state

  • Quality control:

    • UV-Vis spectroscopy to verify chromophore binding

    • SDS-PAGE to assess purity (>90% is typically achievable)

    • Circular dichroism to confirm secondary structure

Store purified rhodopsin at -20°C/-80°C in buffer containing 6% trehalose, with pH 8.0, and avoid repeated freeze-thaw cycles . Adding glycerol (5-50% final concentration) is recommended for long-term storage.

How can the functionality of recombinant rhodopsin be assessed in vitro?

Several complementary methods can verify the functionality of purified recombinant rhodopsin:

  • Spectroscopic analysis:

    • UV-Visible absorption spectroscopy to confirm characteristic absorbance maximum (typically ~500 nm for rhodopsins)

    • Monitor light-induced spectral shifts indicating photoisomerization

    • Measure the ratio of A280/Amax to assess chromophore occupancy

  • Retinal binding assays:

    • Verify Schiff base formation using hydroxylamine sensitivity

    • Assess retinal binding kinetics by monitoring spectral changes during reconstitution with 11-cis-retinal

    • Measure thermal stability of the chromophore-protein complex

  • G-protein activation assays (for Type II rhodopsins):

    • GTPγS binding assays to measure nucleotide exchange on G proteins

    • BRET or FRET-based assays to monitor protein-protein interactions

    • Reconstitution with transducin to measure light-dependent activation

  • Structural integrity verification:

    • Circular dichroism to assess secondary structure content

    • Thermal denaturation to determine stability

    • Limited proteolysis to probe folding quality

  • Light-dependent conformational changes:

    • FTIR spectroscopy to monitor structural rearrangements

    • EPR with site-directed spin labeling to track movement of specific domains

    • Time-resolved fluorescence to capture dynamics of the photocycle

When interpreting functional data, researchers should note that the photochemical properties of rhodopsin may change slightly when removed from its native membrane environment or when tags are added for purification purposes.

How can site-directed mutagenesis reveal structure-function relationships in C. inermis rhodopsin?

Site-directed mutagenesis is a powerful approach to investigate the key residues involved in rhodopsin function:

Key residues for targeted mutagenesis:

  • Retinal binding pocket:

    • The lysine residue that forms the Schiff base with retinal (corresponding to Lys296 in bovine rhodopsin)

    • Counterion residues that stabilize the protonated Schiff base

    • Residues that control spectral tuning through interactions with the retinal polyene chain

  • G-protein interaction sites:

    • Cytoplasmic loop residues, particularly those in the E(D)RY motif that are critical for G-protein activation

    • C-terminal residues involved in signaling complex formation

  • Structural motifs:

    • Conserved residues in transmembrane domains that maintain protein stability

    • Residues involved in intramolecular hydrogen bonding networks

Experimental design for mutagenesis studies:

  • Generate point mutations using PCR-based methods

  • Express mutant proteins using the same system optimized for wild-type

  • Compare spectral properties (absorption maximum, extinction coefficient)

  • Assess thermal stability and chromophore regeneration rates

  • Measure G-protein activation efficiency for functional mutants

  • For cold-adapted fish rhodopsins like C. inermis, examine how mutations affect temperature sensitivity

Example of potential findings from mutagenesis:

MutationExpected EffectAssessment Method
K296A (Schiff base lysine)Loss of retinal bindingUV-Vis spectroscopy
E113Q (counterion)Shifted absorption maximumSpectral analysis
G90D (disease-associated in humans)Constitutive activityG-protein activation assay
Y301F (retinal pocket)Altered spectral tuningComparative spectroscopy

This approach can reveal which residues in C. inermis rhodopsin contribute to its adaptation to the deep, cold-water environment of Lake Baikal.

What evidence supports convergent versus divergent evolution in animal and microbial rhodopsins?

The evolutionary relationship between animal and microbial rhodopsins remains a fascinating question in molecular evolution:

Evidence supporting convergent evolution:

  • Lack of sequence homology: Type I and Type II rhodopsins show no detectable sequence similarity, suggesting independent origins .

  • Functional differences: Animal rhodopsins function as GPCRs, while microbial rhodopsins primarily serve as ion transporters and phototaxis sensors .

  • Distinct photocycles: The two types have different dark states (11-cis vs. all-trans retinal) and photocycle intermediates .

  • Engineering evidence: Functional bacteriorhodopsin variants with novel folds can be engineered, suggesting the rhodopsin fold is not uniquely required for photosensitive activity .

Evidence questioning strict convergence:

  • Structural similarities: Both share the seven transmembrane α-helix arrangement and retinal binding through a Schiff base to a lysine in helix G .

  • Common molecular properties: Both exhibit similar color sensitivity and photoreaction mechanisms involving retinal isomerization .

  • Ancient origin: The shared structural features could reflect a very ancient divergence beyond the detection limit of current sequence analysis methods.

Recent research indicates that animal and microbial rhodopsins may have "convergently evolved from their distinctive origins as multi-colored retinal-binding membrane proteins whose activities are regulated by light and heat but independently evolved for different molecular and physiological functions in the cognate organism" .

This represents a more nuanced view than strict convergence or divergence, suggesting partial conservation of ancestral features combined with independent functional adaptations.

How does rhodopsin from deep-water species like C. inermis differ from shallow-water fish rhodopsins?

Rhodopsins from deep-water fish species have evolved specialized adaptations to function in low-light environments:

Spectral tuning adaptations:

Deep-water environments primarily contain blue light (~470-490 nm) due to the filtering properties of water. Consequently, rhodopsins from deep-water species like C. inermis typically show:

  • Blue-shifted absorption maxima: Adapted to match the available light spectrum

  • Higher quantum efficiency: Maximized probability of photon capture

  • Slower thermal isomerization: Reduced dark noise for improved signal detection in dim conditions

Structural features:

  • Key substitutions in the retinal binding pocket: Amino acid changes that influence the electronic environment around the chromophore

  • Modified counterion interactions: Changes affecting protonation state and stability of the Schiff base

  • Altered G-protein coupling efficiency: Enhanced signal amplification in low-light conditions

Physiological differences:

  • Improved thermal stability at cold temperatures: Deep-water environments maintain constant cold temperatures

  • Slower bleaching and regeneration kinetics: Extending the response to rare photon events

  • Enhanced sensitivity to blue-green wavelengths: Matching the spectral profile of deep water

These adaptations likely developed through natural selection in response to the specific light conditions of Lake Baikal, where Cottocomephorus inermis has evolved. Comparative studies between C. inermis rhodopsin and those from shallow-water relatives would provide valuable insights into the molecular basis of visual adaptation to different aquatic environments.

What are the main challenges in structural studies of recombinant rhodopsins?

Structural characterization of rhodopsins presents several unique challenges:

  • Protein stability issues:

    • Rhodopsins tend to denature when removed from their native membrane environment

    • The retinal chromophore is sensitive to light, requiring dark or dim-red light conditions

    • Maintaining the protein-chromophore Schiff base linkage during purification and crystallization is difficult

  • Crystallization challenges:

    • As membrane proteins, rhodopsins require detergents or lipid systems for solubilization

    • Detergent micelles can interfere with crystal contacts

    • Identifying optimal crystallization conditions often requires extensive screening

    • The flexible loop regions can hinder formation of well-ordered crystals

  • Functional state capture:

    • Photointermediates are transient and difficult to trap for structural studies

    • The photocycle proceeds through multiple states with different kinetics

    • Capturing specific conformational states may require special stabilizing mutations or conditions

  • Technical limitations:

    • Cryo-EM studies are challenging due to the relatively small size of rhodopsins (~40 kDa)

    • X-ray free-electron laser (XFEL) techniques require specialized facilities

    • NMR studies face challenges with spectral quality and assignment

To overcome these challenges, researchers are applying emerging technologies such as time-resolved crystallography using X-ray free-electron lasers (XFEL), which has successfully been applied to bovine rhodopsin to uncover the sequential process of structural changes after photoisomerization .

How can recombinant rhodopsins be utilized in optogenetic applications?

Recombinant rhodopsins offer promising tools for optogenetics due to their intrinsic light sensitivity:

Advantages of rhodopsin-based optogenetic tools:

  • Fast kinetics: Rhodopsins respond to light on millisecond timescales

  • No cofactor requirements: Unlike many optogenetic tools, rhodopsins only require retinal, which is abundant in mammalian tissues

  • Spectral diversity: Different rhodopsins respond to different wavelengths

  • Compact size: The small gene size facilitates viral packaging for delivery

Potential applications of C. inermis rhodopsin:

  • Neural activity modulation:

    • If coupled to mammalian G-protein pathways, C. inermis rhodopsin could trigger specific signaling cascades upon light stimulation

    • Its adaptation to deep-water environments might provide unique spectral properties useful for in vivo applications

  • Biosensor development:

    • Engineered C. inermis rhodopsin variants could serve as optical sensors of membrane potential or GPCR activity

    • FRET-based systems could be developed with rhodopsin as the light-sensing component

  • Cellular control systems:

    • Light-dependent control of second messenger systems (cAMP, calcium, etc.)

    • Regulation of gene expression through light-controlled transcription factors

Steps for developing optogenetic applications:

  • Optimize codon usage for expression in target cells

  • Engineer chimeric proteins with functional domains from mammalian GPCRs

  • Test spectral sensitivity and kinetics in mammalian cell culture

  • Evaluate light power requirements and potential phototoxicity

  • Develop delivery methods for in vivo applications

This research direction requires interdisciplinary collaboration between structural biologists, neuroscientists, and bioengineers to realize the full potential of rhodopsin-based optogenetic tools.

What techniques can reveal the photocycle dynamics of C. inermis rhodopsin?

Understanding the complete photocycle of C. inermis rhodopsin requires time-resolved techniques spanning femtoseconds to seconds:

Ultrafast processes (femtoseconds to picoseconds):

  • Ultrafast spectroscopy:

    • Femtosecond transient absorption spectroscopy to capture initial isomerization events

    • Stimulated Raman spectroscopy to track specific bond vibrations during isomerization

    • Fluorescence upconversion to monitor excited state dynamics

Intermediate states (nanoseconds to milliseconds):

  • Time-resolved crystallography:

    • Time-resolved X-ray crystallography using pump-probe approaches

    • Serial femtosecond crystallography at X-ray free-electron laser facilities to capture intermediate states

  • Spectroscopic methods:

    • Flash photolysis with UV-Vis detection to identify spectral intermediates

    • Time-resolved FTIR to monitor protein conformational changes

    • Time-resolved fluorescence to track changes in protein environment

Slow kinetics (milliseconds to seconds):

  • Electrophysiology:

    • Patch-clamp recordings if expressed in cell systems

    • TEVC (two-electrode voltage clamp) in Xenopus oocytes

  • Functional assays:

    • GTPγS binding kinetics to measure G-protein activation rates

    • Calcium imaging to monitor downstream signaling

Sample experimental setup for complete photocycle characterization:

  • Express and purify recombinant C. inermis rhodopsin

  • Reconstitute in lipid nanodiscs or liposomes

  • Perform flash photolysis with multilength detection to identify intermediates

  • Use global fitting analysis to determine rate constants between states

  • Compare results with known rhodopsin photocycles from model systems

This comprehensive approach would yield a detailed kinetic model of the C. inermis rhodopsin photocycle, revealing adaptations that may be unique to this deep-water species.

How can rhodopsin spectral tuning be engineered to create variants with altered absorption spectra?

Spectral tuning of rhodopsins through protein engineering offers valuable tools for both basic research and applications:

Key principles of rhodopsin spectral tuning:

The absorption maximum of rhodopsin is determined by:

  • The electronic environment around the retinal chromophore

  • The protonation state of the Schiff base

  • The degree of planarity in the polyene chain of retinal

  • Specific interactions between the protein and chromophore

Targeted amino acid substitutions for spectral tuning:

Based on studies of naturally occurring rhodopsin variants and structure-function analyses, several key positions have been identified for spectral tuning:

Residue Position (bovine numbering)Effect when mutatedSpectral Shift
E113 (counterion)Alters Schiff base electrostaticsMajor (30-60 nm)
E181Affects hydrogen bonding networkModerate (10-20 nm)
S186Interacts with C12 of retinalMinor (5-15 nm)
H211Part of retinal binding pocketModerate (10-25 nm)
W265Constrains retinal geometryMinor to moderate (5-20 nm)
A292Controls retinal positioningModerate (10-25 nm)

Engineering methodology:

  • Rational design approach:

    • Identify corresponding residues in C. inermis rhodopsin based on sequence alignment

    • Create point mutations using site-directed mutagenesis

    • Express and purify variants

    • Characterize spectral properties using absorption spectroscopy

  • Directed evolution approach:

    • Create libraries of random or semi-random mutations in the retinal binding pocket

    • Develop a screening system based on colored colony selection or fluorescence

    • Iteratively select variants with desired spectral properties

    • Sequence and characterize successful variants

  • Combinatorial approach:

    • Combine multiple mutations with known individual effects

    • Test for additive, synergistic, or antagonistic effects

    • Develop predictive models for spectral tuning

Engineering spectral variants of C. inermis rhodopsin could provide insights into how this species has adapted to the light environment of Lake Baikal and create useful tools for optogenetic applications with different wavelength sensitivities.

What insights can comparative analysis of rhodopsins from different aquatic species provide?

Comparative analysis of rhodopsins across aquatic species reveals evolutionary adaptations to diverse light environments:

Evolutionary insights:

  • Adaptive evolution signatures:

    • Identify sites under positive selection pressure

    • Correlate amino acid changes with environmental parameters (depth, water clarity, light spectrum)

    • Reconstruct ancestral sequences to track evolutionary trajectories

  • Convergent adaptations:

    • Detect parallel amino acid substitutions in unrelated species from similar environments

    • Assess if deep-water species from different lineages show similar adaptations

    • Determine the structural basis for convergent spectral tuning

Functional comparisons:

A systematic comparison of C. inermis rhodopsin with those from other aquatic environments could reveal:

SpeciesHabitatExpected AdaptationsResearch Value
C. inermis (Baikal sculpin)Deep, clear freshwater lakeBlue-shifted spectrum, high sensitivityBase comparison
Shallow-water freshwater fishSurface waters with broad spectrumBroader spectral sensitivityContrast with deep adaptation
Marine deep-sea fishDeep ocean (blue-only light)Extreme blue shift, ultra-high sensitivityConvergent adaptation comparison
Antarctic fishCold, seasonal light variationCold stability, variable sensitivityTemperature adaptation comparison
Cave fishComplete darknessReduced function or repurposed rhodopsinRegressive evolution comparison

Methodological approach:

  • Collect rhodopsin sequences from diverse fish species with known habitat data

  • Perform phylogenetic analysis to establish evolutionary relationships

  • Identify sites showing evidence of positive selection

  • Express and characterize selected rhodopsins to correlate sequence with function

  • Use homology modeling and molecular dynamics to predict structural mechanisms

This comparative approach would place C. inermis rhodopsin in an evolutionary context, revealing how its structure relates to the specific environmental challenges of Lake Baikal.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.