Recombinant Coturnix coturnix japonica Anti-apoptotic protein NR13 (NR13)

Shipped with Ice Packs
In Stock

Description

Overview

Recombinant Coturnix coturnix japonica Anti-apoptotic protein NR13 (NR13) is a protein derived from the Japanese quail (Coturnix coturnix japonica) and produced using recombinant DNA technology . NR13 is also known as Apoptosis regulator Nr-13 and is noted for its anti-apoptotic properties . Apoptosis, or programmed cell death, is a crucial biological process, and NR13 is involved in its regulation .

Basic Information

PropertyDescription
Product CodeCSB-CF845855DXJ
Uniprot No.Q90343
Sourcein vitro E. coli expression system
Target NameNR13
Other NamesAnti-apoptotic protein NR13, Apoptosis regulator Nr-13
Immunogen SpeciesCoturnix japonica (Japanese quail)
SequenceMPGSLKEETALLLEDYFQHRAGGAALPPSATAAELRRAAAELERRERPFFRSCAPLARAEPREAAALLRKVAAQLETDGGLNWGRLLALVVFAGTLAAALAESACEEGPSRLAAALTAYLAEEQGEWMEEHGGWDGFCRFFGRHGSQPADQNSTLSNAIMAAAGFGIAGLAFLLVVR
Expression Region1-177
Tag InfoN-terminal 10xHis-tagged
Protein LengthFull length protein

Biological Role

NR13 is identified as an anti-apoptotic protein, suggesting it plays a role in inhibiting programmed cell death . The specific mechanisms and pathways through which NR13 exerts its anti-apoptotic effects require further investigation.

Applications in Research

NR13 can be employed in various research applications, including:

  • Apoptosis Studies: Investigating the mechanisms of apoptosis and the role of NR13 in cell survival .

  • Protein-Protein Interaction Studies: Identifying proteins that interact with NR13 to elucidate its function .

  • Drug Discovery: Screening for compounds that can modulate the activity of NR13 for therapeutic purposes .

  • Model Development: Japanese quail (Coturnix japonica) can be utilized as models to understand the relationship between stress and the microbiome .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
NR13; Anti-apoptotic protein NR13; Apoptosis regulator Nr-13
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-177
Protein Length
full length protein
Species
Coturnix japonica (Japanese quail) (Coturnix coturnix japonica)
Target Names
NR13
Target Protein Sequence
MPGSLKEETALLLEDYFQHRAGGAALPPSATAAELRRAAAELERRERPFFRSCAPLARAE PREAAALLRKVAAQLETDGGLNWGRLLALVVFAGTLAAALAESACEEGPSRLAAALTAYL AEEQGEWMEEHGGWDGFCRFFGRHGSQPADQNSTLSNAIMAAAGFGIAGLAFLLVVR
Uniprot No.

Target Background

Function
Demonstrates anti-apoptotic properties and counteracts the pro-apoptotic effects of BAX.
Protein Families
Bcl-2 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Mainly expressed in neural and muscular tissues.

Q&A

What is NR13 and what is its biological significance?

NR13 is an anti-apoptotic protein belonging to the Bcl-2 family that plays a crucial role in regulating programmed cell death (apoptosis) in Japanese quail (Coturnix coturnix japonica) . The biological significance of NR13 lies in its temporal expression pattern during development. NR13 is expressed at high levels in the embryonic bursa of Fabricius, with expression decreasing significantly after hatching, which inversely correlates with apoptosis levels . This pattern suggests NR13 plays a critical role in maintaining bursal stem cells during embryonic development by inhibiting premature apoptosis . Understanding NR13 function provides insights into fundamental mechanisms of cell survival and tissue development, particularly in the context of avian immune system development where the bursa of Fabricius serves as the primary site for B-cell maturation.

How does NR13 compare structurally and functionally to other members of the Bcl-2 family?

NR13 shares structural homology with other anti-apoptotic Bcl-2 family members, containing critical Bcl-2 homology (BH) domains that mediate protein-protein interactions . The protein contains 177 amino acids with a sequence that includes BH domains necessary for its anti-apoptotic function . Most notably, NR13 contains a critical BH4 domain that is essential for its anti-apoptotic activity, as deletion of this domain converts NR13 from a death antagonist to a death agonist .

Functionally, NR13 operates similarly to other anti-apoptotic Bcl-2 family members by interacting with pro-apoptotic proteins, particularly Bax . Coimmunoprecipitation studies have demonstrated that NR13 physically interacts with Bax, suggesting that this interaction is a key mechanism by which NR13 inhibits apoptosis . This mechanism parallels other anti-apoptotic Bcl-2 family members, which typically function by sequestering pro-apoptotic molecules to prevent mitochondrial outer membrane permeabilization and subsequent activation of caspase cascades.

What evolutionary relationships exist between NR13 and its mammalian homologues?

NR13 has identifiable homologues in mammals, including human Nrh and mouse Diva/Boo . Phylogenetic analyses suggest that human Nrh, mouse Diva/Boo, and quail Nr-13 are orthologous genes, indicating they evolved from a common ancestral gene and likely retain similar functions despite species divergence . The evolutionary conservation of these genes suggests they play fundamental roles in apoptotic regulation across vertebrate species.

The gene structure of NR13 is conserved across species, with the NR13, Nrh, and Diva/Boo genes all sharing a similar organization featuring a single intron that interrupts the open reading frame at the level of the Bcl-2-homology domain BH2 . This conservation in gene structure further supports their orthologous relationship and suggests functional conservation throughout evolution. The human homologue Nrh is preferentially expressed in the lungs, liver, and kidneys, indicating possible tissue-specific functions that may differ from the predominantly immunological role of NR13 in avian species .

What are the molecular mechanisms by which NR13 inhibits apoptosis?

NR13 inhibits apoptosis through several molecular mechanisms. The primary mechanism involves direct interaction with pro-apoptotic proteins, particularly Bax . Coimmunoprecipitation studies have demonstrated that NR13 physically binds to Bax, preventing it from forming oligomers that would otherwise create pores in the mitochondrial outer membrane . This interaction depends on NR13's BH4 domain, as deletion of this domain not only eliminates NR13's anti-apoptotic function but converts it into a death agonist .

Additionally, NR13 appears to be regulated at both transcriptional and post-translational levels in response to cellular signals. The oncogene v-rel and phorbol myristate acetate, both known inhibitors of bursal cell apoptosis, induce NR13 expression, suggesting that NR13 serves as a downstream effector in several anti-apoptotic signaling pathways . At the post-translational level, NR13 levels diminish when bursal lymphoblasts are induced to undergo apoptosis by dispersion, while Bax levels increase . This reciprocal relationship between NR13 and Bax levels further supports their antagonistic relationship in regulating apoptosis.

Research has also revealed that the human homologue Nrh is associated with mitochondria and the nuclear envelope, and preferentially associates with the apoptosis accelerator Bcl-Xs . This subcellular localization is consistent with its role in preventing mitochondrial outer membrane permeabilization, a key step in the intrinsic apoptotic pathway.

How can contradictory data regarding NR13 function be reconciled in experimental designs?

Contradictory data regarding NR13 function can arise from several sources, including variations in experimental conditions, cell types, and species-specific differences. To reconcile these contradictions, researchers should implement a multi-faceted approach:

  • Standardized expression systems: When working with recombinant NR13, standardize expression systems and purification protocols to ensure consistent protein quality and activity . Different tagging strategies (N-terminal vs. C-terminal) and expression hosts (E. coli, mammalian cells) can affect protein folding and function.

  • Context validation: As highlighted in recent literature on Retrieval Augmented Generation systems, implementing a context validation step can help identify contradictory information within experimental datasets . This involves systematically comparing results across multiple experimental conditions and identifying potential sources of variability.

  • Cross-species comparison: When extrapolating functions between species (e.g., from quail NR13 to human Nrh), account for potential species-specific differences by performing parallel experiments in both systems . The evolutionary distance between species may result in functional divergence despite sequence similarity.

  • Domain-specific analysis: Since deletion of the BH4 domain converts NR13 from an anti-apoptotic to pro-apoptotic protein, contradictory results may stem from protein truncations or modifications . Ensure that the full-length protein with intact domains is used in functional studies.

  • Conditional dependencies: Consider that NR13 function may be conditional on cellular context, developmental stage, or environmental conditions. For instance, NR13's role may differ between embryonic and post-hatching stages, or under normal versus stress conditions .

What are the implications of NR13 research for understanding cell death regulation across species?

Research on NR13 has significant implications for understanding evolutionary conservation of cell death regulation mechanisms. The identification of orthologous genes in humans (Nrh), mice (Diva/Boo), and quail (NR13) suggests fundamental conservation of apoptotic regulation across vertebrates . This conservation provides a framework for translational research, where findings in avian models may inform understanding of human cell death pathways.

NR13 research demonstrates the critical balance between pro- and anti-apoptotic signals during development. The high expression of NR13 in embryonic bursa followed by post-hatching downregulation illustrates how temporal regulation of anti-apoptotic proteins shapes tissue development and function . This principle of temporal regulation likely extends to mammalian development and tissue homeostasis.

The finding that NR13 prevents the programmed elimination of bursal stem cells after hatching provides insights into mechanisms of stem cell maintenance . This has implications for research on tissue regeneration, stem cell biology, and age-related degeneration across species. Understanding how NR13 protects stem cells may inform strategies to maintain stem cell populations in therapeutic applications.

Furthermore, the dual functionality of NR13 depending on its domain structure (anti-apoptotic with intact BH4, pro-apoptotic without) highlights the complexity of Bcl-2 family proteins and their potential for context-dependent functions . This complexity must be considered when developing therapeutics targeting Bcl-2 family proteins in human diseases.

What are the optimal protocols for expression and purification of recombinant NR13?

The optimal protocol for expression and purification of recombinant NR13 involves several critical considerations to ensure protein integrity and functionality:

Expression System Selection:
E. coli expression systems have been successfully used for recombinant NR13 production as documented in multiple studies . For transmembrane proteins like NR13, E. coli systems must be carefully optimized to prevent protein aggregation and ensure proper folding.

Tagging Strategy:
N-terminal 10xHis-tagging has been validated for NR13 purification . The tag should be positioned to minimize interference with protein function, particularly avoiding disruption of the critical BH4 domain and the transmembrane region.

Buffer Optimization:
For optimal stability, recombinant NR13 should be stored in Tris-based buffer with 50% glycerol . This composition helps maintain protein structure and prevents aggregation during storage.

Purification Protocol:

  • Transform expression vector containing full-length NR13 sequence (177 amino acids) into competent E. coli cells

  • Induce protein expression with IPTG at optimal concentration and temperature

  • Lyse cells under native conditions to preserve protein structure

  • Purify using nickel affinity chromatography, leveraging the His-tag

  • Elute with imidazole gradient

  • Perform size exclusion chromatography to ensure homogeneity

  • Confirm purity using SDS-PAGE and Western blotting

Storage Conditions:
Store purified NR13 at -20°C for regular use, or at -80°C for extended storage . Avoid repeated freeze-thaw cycles, as these can compromise protein integrity. Working aliquots can be stored at 4°C for up to one week .

Quality Control:
Verify protein identity and integrity through mass spectrometry and circular dichroism to confirm proper folding. Functional assays, such as Bax binding assays, should be performed to verify the anti-apoptotic activity of the purified protein.

How can researchers effectively study NR13's interactions with other Bcl-2 family proteins?

To effectively study NR13's interactions with other Bcl-2 family proteins, researchers should employ a combination of complementary approaches:

Co-immunoprecipitation (Co-IP):
Co-IP has successfully demonstrated NR13's interaction with Bax . Use antibodies specific to NR13 or its binding partners to pull down protein complexes from cell lysates. This technique can be enhanced by using crosslinking agents to stabilize transient interactions before cell lysis.

Yeast Two-Hybrid Assays:
Yeast two-hybrid systems can be employed to screen for novel interaction partners or confirm known interactions. This approach has been used to study NR13's interactions in both yeast and vertebrate cell systems .

Bimolecular Fluorescence Complementation (BiFC):
BiFC allows visualization of protein interactions in living cells by fusing complementary fragments of a fluorescent protein to potential interaction partners. This technique is particularly valuable for observing the subcellular localization of NR13-partner interactions.

Surface Plasmon Resonance (SPR):
SPR provides quantitative binding parameters (association/dissociation constants) for NR13 interactions with purified binding partners. This technique requires purified proteins but offers precise kinetic data on binding events.

Structural Studies:
X-ray crystallography or nuclear magnetic resonance (NMR) spectroscopy of NR13 in complex with binding partners can reveal atomic-level details of interaction interfaces. These approaches are particularly valuable for understanding how the BH4 domain mediates interactions.

Domain Mapping:
Systematic deletion or mutation of specific domains (particularly the BH4 domain) can identify regions critical for protein-protein interactions . This approach should be combined with functional assays to correlate binding with anti-apoptotic activity.

Cell-Based Functional Assays:
Overexpression of NR13 in cell lines such as DT40 bursal lymphoma cells has demonstrated protection against low serum-induced apoptosis . These functional assays can be combined with co-expression of potential interaction partners to assess their impact on NR13's anti-apoptotic function.

What experimental designs can assess NR13 function under different environmental stressors?

To assess NR13 function under different environmental stressors, researchers can implement the following experimental designs:

Heat Stress Models:
Japanese quail are known to experience physiological changes under heat stress, making this a relevant stressor to study . Experimental designs should include:

  • Controlled temperature chambers for both acute (4 hours) and chronic (3+ weeks) heat exposure at temperatures ranging from 31.1°C to 34°C

  • Monitoring of NR13 expression levels using RT-qPCR and Western blotting during heat stress

  • Assessment of apoptosis markers (Annexin V, TUNEL assays) in correlation with NR13 expression

  • Comparison between different genetic lines to assess adaptation potential

Nutrient Deprivation Models:
Since low serum conditions induce apoptosis that can be counteracted by NR13 overexpression , nutrient deprivation represents a valuable experimental stressor:

  • Cell culture systems with controlled reduction of serum or specific nutrients

  • Time-course analysis of NR13 expression and localization during starvation

  • Assessment of cell survival and apoptotic markers in wild-type versus NR13-overexpressing cells

  • Analysis of NR13 interaction partners under nutrient stress using co-IP followed by mass spectrometry

Oxidative Stress Models:
Oxidative stress is a common cellular stressor that often induces apoptosis:

  • Treatment with hydrogen peroxide, paraquat, or other oxidative stress inducers

  • Measurement of reactive oxygen species levels in correlation with NR13 expression

  • Analysis of mitochondrial integrity (membrane potential, cytochrome c release) in cells with varying NR13 levels

  • Assessment of NR13's ability to protect against oxidative stress-induced apoptosis

Transgenic/Knockout Models:
For in vivo assessment, developing transgenic or knockout models can provide comprehensive insights:

  • Creation of NR13 knockout quail using CRISPR/Cas9 technology

  • Development of tissue-specific or inducible NR13 expression systems

  • Exposure of these models to various stressors (heat, pathogen challenge, nutritional stress)

  • Comprehensive phenotypic analysis, including tissue-specific apoptosis rates, developmental progression, and physiological parameters

How should contradictory findings in NR13 expression studies be evaluated and reconciled?

When evaluating contradictory findings in NR13 expression studies, researchers should implement a systematic approach to identify sources of variability and develop a cohesive understanding:

Methodological Framework for Contradiction Resolution:

  • Standardize measurement techniques: Different detection methods (RT-qPCR, Western blotting, immunohistochemistry) may yield apparently contradictory results due to differences in sensitivity and specificity. Researchers should use multiple complementary techniques to confirm expression patterns .

  • Establish temporal resolution: NR13 expression changes significantly across developmental stages, with high expression in embryonic bursa and decreased expression after hatching . Studies conducted at different time points may produce seemingly contradictory results that actually reflect normal temporal variation.

  • Consider tissue-specific expression patterns: The human homologue Nrh shows preferential expression in lungs, liver, and kidneys . Similarly, NR13 may have tissue-specific expression patterns that create apparent contradictions when comparing different tissue types.

  • Examine subcellular localization: NR13's function may depend on its subcellular localization. Contradictory findings might stem from differences in protein distribution rather than total expression levels. Immunohistochemistry or subcellular fractionation can resolve such contradictions .

  • Implement contradiction detection algorithms: Recent advances in information validation can be applied to biological data. Systems that detect self-contradictory data, contradicting data pairs, and conditional contradictions can help identify genuine inconsistencies versus context-dependent differences .

  • Create integrated expression maps: When faced with contradictory expression data, develop comprehensive expression maps that integrate findings across different studies, accounting for variables such as developmental stage, tissue type, and experimental conditions.

What statistical approaches are most appropriate for analyzing NR13 functional studies?

The most appropriate statistical approaches for analyzing NR13 functional studies depend on the experimental design and data characteristics. Here are recommended approaches:

For Expression Studies:

  • Two-way ANOVA: Particularly useful for studies examining NR13 expression across multiple conditions (e.g., heat stress) and time points. This approach was successfully applied in heat stress studies with Japanese quail, where models included treatments, length of exposure, sex, and their interactions .

  • Linear Mixed Models: Appropriate when handling repeated measures or nested experimental designs, especially in longitudinal studies tracking NR13 expression over time.

  • Post-hoc tests: When significant differences are identified through ANOVA, employ Tukey's or Bonferroni-corrected tests to determine which specific conditions differ significantly.

For Survival and Apoptosis Assays:

  • Kaplan-Meier survival analysis: For time-to-event data (such as cell survival under stress conditions), with log-rank tests to compare survival between NR13-expressing and control cells.

  • Cox proportional hazards models: To assess the influence of multiple variables (NR13 expression levels, environmental conditions) on survival outcomes.

  • Dose-response curves: For studies examining the relationship between varying levels of NR13 expression and apoptotic resistance.

For Protein-Protein Interaction Studies:

  • Correlation analyses: Pearson or Spearman correlation to assess the relationship between NR13 and partner protein levels.

  • Binding kinetics models: Non-linear regression models to determine association and dissociation constants from SPR or similar data.

For Multi-omics Integration:

  • Principal Component Analysis (PCA): To identify patterns in multidimensional data sets combining transcriptomics, proteomics, and functional assays.

  • Hierarchical clustering: To identify groups of genes or conditions with similar patterns related to NR13 function.

  • Network analysis: To visualize and quantify NR13's position within broader protein interaction networks.

Power Analysis Considerations:
Prior to experimental design, conduct power analyses to determine appropriate sample sizes. For studies with Japanese quail, considering the genetic diversity found in different lines is essential for robust statistical design .

How can researchers integrate NR13 findings with broader cell death pathway data?

Integrating NR13 findings with broader cell death pathway data requires a multifaceted approach that connects molecular mechanisms to systemic outcomes:

Multi-level Integration Framework:

  • Pathway Mapping: Position NR13 within the broader Bcl-2 family network by constructing comprehensive interaction maps. Include both direct binding partners like Bax and indirect regulatory relationships. Use publicly available databases (STRING, BioGRID) to expand these networks beyond experimentally verified interactions.

  • Cross-species Comparative Analysis: Leverage the orthologous relationship between NR13, human Nrh, and mouse Diva/Boo to identify conserved and divergent aspects of apoptotic regulation . This approach can highlight core mechanisms while accounting for species-specific adaptations.

  • Temporal Dynamics Modeling: Develop mathematical models that capture the dynamic relationship between NR13 expression and apoptosis rates during development, particularly focusing on the transition from embryonic to post-hatching periods in the bursa of Fabricius .

  • Multi-omics Integration: Combine transcriptomics (NR13 expression levels), proteomics (interaction partners), and functional data (apoptosis assays) to create comprehensive models of how NR13 influences cell fate decisions. Machine learning approaches can help identify patterns across these diverse data types.

  • Contextual Conditionality Analysis: Implement frameworks for detecting conditional contradictions in biological data . This approach can identify scenarios where NR13's function depends on specific cellular contexts or the presence of particular regulatory molecules.

  • Phenotypic Correlation: Connect molecular-level findings about NR13 to organismal phenotypes. For example, correlate NR13 expression patterns with physiological parameters in heat stress experiments or immune system development.

  • Evolutionary Conservation Mapping: Map the conservation of NR13 function across phylogenetically diverse species. This approach can distinguish fundamental aspects of apoptotic regulation from species-specific adaptations and provide context for interpreting experimental results.

Table of Experimental Conditions for NR13 Functional Studies

Experimental ParameterBasic ConditionsAdvanced ConditionsMeasurement Techniques
Heat Stress Protocol31.1°C for 4 hours (acute) or 3 weeks (chronic)Temperature gradient (32-34°C) with varying humidityRT-qPCR, Western blot for NR13, blood gas analysis
Expression SystemsE. coli with N-terminal 10xHis tagMammalian expression, cell-free systemsWestern blot, ELISA, mass spectrometry
Storage Conditions-20°C in Tris buffer with 50% glycerolLyophilization, various buffer compositionsStability assays, functional testing
Protein Interaction StudiesCo-IP with BaxYeast two-hybrid, BiFC, SPRPull-down assays, fluorescence microscopy
Functional AssaysLow serum-induced apoptosis in DT40 cellsOxidative stress, heat shock, cytokine withdrawalAnnexin V/PI staining, caspase activity, TUNEL
Domain AnalysisBH4 domain deletionPoint mutations, chimeric proteinsCircular dichroism, thermal shift assays
In vivo ModelsBursal transplantation studiesTransgenic/knockout quail linesHistology, immunohistochemistry

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.