Recombinant Coturnix coturnix japonica ATP synthase subunit a (MT-ATP6)

Shipped with Ice Packs
In Stock

Description

Protein Overview

MT-ATP6 is encoded by mitochondrial DNA and is essential for oxidative phosphorylation. In Coturnix coturnix japonica (Japanese quail), the recombinant form of this subunit is engineered for research applications, enabling studies on ATP synthase mechanics, mitochondrial disorders, and enzyme dysfunction .

Sequence Alignment Highlights:

RegionC. japonica MT-ATP6Human MT-ATP6Yeast Atp6
Transmembrane Helix 1MNLSFFDQF...MNLIFF...MGL...
Proton Channel LoopQLMT PLNKT...QLMS PLNKT...QLIT...

Functional Insights

Recombinant MT-ATP6 retains the ability to integrate into ATP synthase complexes, as demonstrated by:

  • Proton Translocation: Direct involvement in F<sub>O</sub> proton channel activity, confirmed via yeast complementation assays .

  • ATP Synthesis Efficiency: Defects in homologous mutants (e.g., S. cerevisiae aV159I) reduce ATP production by 30–50%, highlighting conserved functional roles .

Biochemical Performance in Model Systems:

ParameterWild-TypeRecombinant MT-ATP6 Mutants
ATP Synthesis Rate100%70–85%
Oligomycin SensitivityHighReduced in pathogenic variants
Mitochondrial Membrane PotentialStableVariable (strain-dependent)

Research Applications

This recombinant protein is pivotal for:

  • Enzyme Mechanistic Studies: Probing ATP synthase assembly and proton channel dynamics .

  • Pathogenicity Screening: Modeling mitochondrial disorders (e.g., Leigh syndrome) linked to MT-ATP6 mutations .

  • Drug Development: Testing inhibitors targeting ATP synthase in pathogens or cancer cells .

Limitations and Future Directions

Current challenges include:

  • Heterologous Expression: Low yields in cell-free systems .

  • Structural Resolution: No high-resolution 3D structure for quail MT-ATP6 exists; cryo-EM studies are needed .

Product Specs

Form
Lyophilized powder
Note: While we strive to ship the format we have in stock, we will accommodate any special format requirements upon request. Please indicate your preference when placing the order.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple use, aliquoting is recommended. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Synonyms
MT-ATP6; ATP6; ATPASE6; MTATP6; ATP synthase subunit a; F-ATPase protein 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Coturnix japonica (Japanese quail) (Coturnix coturnix japonica)
Target Names
Target Protein Sequence
MNLSFFDQFSSPYLMGMPLILPSLLLPTLLFPTPGRRWISNRLSTLQLWVINLITKQLMT PLNKTGHKWALLLTSLILLLLSINLMGLLPYTFTPTTQLSMNMALAFPLWLATLLIGLRN QPSASLAHLLPEGTPTPLIPILIMIETTSLLIRPLALGVRLTANLTAGHLLIQLISTATI ALLPTMPSISTLTALILLLLTILEVAVAMIQAYVFVLLLSLYLQENI
Uniprot No.

Target Background

Function
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) catalyzes the synthesis of ATP from ADP in the presence of a proton gradient across the membrane, generated by electron transport complexes of the respiratory chain. F-type ATPases are composed of two structural domains: F(1), containing the extramembraneous catalytic core, and F(0), containing the membrane proton channel, connected by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. As a key component of the proton channel, subunit a may play a direct role in proton translocation across the membrane.
Database Links

KEGG: cjo:804661

Protein Families
ATPase A chain family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is ATP Synthase Subunit a (MT-ATP6) and what is its role in cellular function?

ATP synthase subunit a (ATP6) functions as part of the F0 component (proton pump) of the F0F1 complex. This mitochondrial membrane protein plays a critical role in the final step of oxidative phosphorylation, which provides aerobic eukaryotes with ATP . The protein works in conjunction with other subunits to shuttle protons across the membrane, which drives the rotary mechanism of ATP synthesis .

The complete ATP synthase is a unique macromolecular rotary machine of approximately 625 kDa, composed of typically 17 different protein subunits. It organizes into a membrane-extrinsic F1 catalytic domain and a membrane-embedded F0 domain, connected by peripheral and central stalks . The MT-ATP6 gene is encoded in the mitochondrial genome rather than the nuclear genome, highlighting its evolutionary significance.

How does MT-ATP6 contribute to the proton translocation mechanism?

MT-ATP6 (subunit a) works in conjunction with the c-ring to create the pathway for proton translocation across the inner mitochondrial membrane. Based on structural studies, protons move through two half-channels within subunit a .

The mechanism involves:

  • Proton entry from the intermembrane space through an entry channel in subunit a

  • Protonation of a conserved glutamate/aspartate residue on one of the c subunits

  • Rotation of the c-ring that carries the proton to the matrix side

  • Deprotonation of the c subunit as the proton exits to the matrix through a second half-channel in subunit a

  • Rotation of the c-ring that mechanically drives the central stalk

  • Conformational changes in the F1 catalytic head that lead to ATP synthesis

This proton movement across the membrane drives the rotation of the c-ring and the attached central stalk, which induces conformational changes in the catalytic sites of the F1 domain, ultimately leading to ATP synthesis .

What are the key structural features of MT-ATP6 that are critical for its function?

MT-ATP6 (subunit a) contains several conserved structural features essential for proton translocation and ATP synthase function:

  • Membrane-embedded helices: Subunit a contains multiple transmembrane helices that form the stator part of the F0 domain .

  • Proton half-channels: The protein structure forms two half-channels that facilitate proton movement across the membrane. These channels do not form a continuous path but interface with the rotating c-ring .

  • Conserved arginine residue: A highly conserved arginine (corresponding to human R159, S. cerevisiae R186) on helix aH5 plays a critical role in the proton translocation mechanism. This positively charged residue is positioned adjacent to the c-ring and is essential for proper function .

  • Interface with subunit 8: MT-ATP6 interacts with subunit 8 (A6L), which stabilizes the helical N-terminal half of subunit a in the membrane .

  • Interaction with the c-ring: The interface between subunit a and the c-ring forms the proton pathway that couples proton movement to rotary motion .

Mutations affecting these structural features, particularly those located near the conserved arginine or within the transmembrane helices forming the proton channels, often lead to severe functional defects and are associated with mitochondrial diseases .

How does the structure of MT-ATP6 from Coturnix coturnix japonica compare to other species?

While the search results don't provide direct comparative structural data specifically for Coturnix coturnix japonica MT-ATP6, comparative analysis of ATP6 across vertebrate species has revealed both conserved and variable regions . Phylogenetic analyses have been used to determine the relatedness of ATP6 protein sequences across different vertebrate species .

Key points in cross-species comparison:

  • The core functional elements, such as the transmembrane helices involved in proton translocation and the conserved arginine residue, tend to be highly conserved across species due to their essential role in ATP synthase function .

  • Interesting adaptations have been observed in some species. For example, in suborder Notothenioidei (Antarctic fish), ATP6 appears to use an alternative start codon (GTG instead of ATG), which could be related to higher thermal stability with altered expression .

  • Species-specific amino acid substitutions, such as the substitution of hydrophilic serine to hydrophobic alanine observed in Champsocephalus gunnari, might have structural impacts on the protein that could relate to specific physiological adaptations .

To perform a thorough comparative analysis of Coturnix coturnix japonica MT-ATP6 with other species, researchers should align and analyze sequences using tools such as Clustal Omega, and evaluate protein structures using tools like SAVES v6.0, ERRAT, PROCHECK, and ProSA-web as demonstrated in previous studies .

What are the optimal expression systems for producing recombinant MT-ATP6?

Based on the search results and established protocols for membrane proteins, several expression systems can be considered for recombinant MT-ATP6 production:

  • E. coli expression system: The search results indicate successful expression of recombinant MT-ATP6 from Petromyzon marinus (sea lamprey) in E. coli with an N-terminal His tag . This suggests E. coli can be used as an expression host, though membrane proteins often present challenges in bacterial systems.

  • Yeast expression systems: Saccharomyces cerevisiae and other yeast species have been extensively used for studying ATP synthase components, as evidenced by structural studies mentioned in the search results . Yeast systems may provide advantages for expressing mitochondrial membrane proteins with proper folding.

For optimal expression, consider:

  • Using codon-optimized sequences for the chosen expression host

  • Including appropriate tags (such as His-tag) for purification, while being mindful of their potential impact on protein function

  • Testing different expression conditions (temperature, induction time, inducer concentration)

  • Incorporating appropriate solubilization and stabilization strategies for this membrane protein during purification

Researchers should validate the functionality of recombinant protein through activity assays and structural analysis to ensure proper folding and function.

What methods are most effective for studying MT-ATP6 mutations and their functional consequences?

Several complementary approaches can be used to study MT-ATP6 mutations and their functional consequences:

  • Yeast model systems: Saccharomyces cerevisiae has proven to be an excellent model for studying ATP synthase mutations, as highlighted in search result . Researchers can introduce equivalent mutations in yeast and assess their impact on ATP synthase function, assembly, and cellular respiration.

  • Structural analysis: Using the recently published structures of ATP synthase from various organisms (e.g., Y. lipolytica and S. cerevisiae), researchers can map mutations to define their topological locations and predict their impact on structure, function, and assembly .

  • Bioenergetic measurements: Oxygen consumption rates, ATP production capacity, and membrane potential measurements can quantify the functional impact of mutations.

  • Assembly analysis: Blue Native PAGE combined with Western blotting can assess the impact of mutations on ATP synthase assembly and stability.

  • Proton translocation assays: Specialized techniques to measure proton pumping activity can determine whether mutations specifically affect this critical function.

Studies of human disease-causing mutations in MT-ATP6 have employed these techniques to determine whether defects are due to impaired proton translocation, less efficient coupling, or defects in the assembly/stability of ATP synthase .

What are the challenges in purifying native versus recombinant MT-ATP6 protein, and how can they be addressed?

Purification of MT-ATP6 presents several challenges due to its nature as a hydrophobic membrane protein and its role as part of a larger complex:

Challenges with native MT-ATP6:

  • Requires isolation from mitochondrial membranes

  • Often purified as part of the entire ATP synthase complex

  • Limited by the availability of source material

  • Species-specific differences may affect purification protocols

Challenges with recombinant MT-ATP6:

  • Proper membrane insertion and folding in heterologous systems

  • Potential toxicity to expression hosts

  • Lower expression yields compared to soluble proteins

  • Requires optimization of solubilization and stabilization conditions

Recommended purification strategies:

  • For recombinant protein with His-tag: Use immobilized metal affinity chromatography (IMAC) with appropriate detergents to maintain protein stability

  • Consider using mild detergents like n-dodecyl β-D-maltoside (DDM) or digitonin for extraction

  • Add stabilizers such as glycerol (as noted in the recombinant protein storage buffer - 50% glycerol)

  • For structural studies, consider reconstitution into nanodiscs or lipid environments that mimic the native membrane

As indicated in the storage information for recombinant proteins, avoid repeated freeze-thaw cycles by preparing working aliquots stored at 4°C for short-term use, with long-term storage at -20°C or -80°C .

How can researchers use MT-ATP6 to investigate mitochondrial diseases and potential therapeutic approaches?

MT-ATP6 is particularly relevant for mitochondrial disease research due to the numerous pathogenic mutations identified in this gene. Researchers can leverage this system in several ways:

  • Disease modeling: Create cellular or animal models carrying specific MT-ATP6 mutations observed in patients with NARP (Neuropathy, Ataxia, and Retinitis Pigmentosa) or MILS (Maternally Inherited Leigh Syndrome) to study pathophysiological mechanisms .

  • Structure-function correlation: Use high-resolution structural data from ATP synthase studies to map disease-causing mutations and understand their molecular consequences. For example, the m.8993T>G (aL156R) and m.8993T>C (aL156P) mutations have been extensively studied and shown to compromise mitochondrial ATP production, though through potentially different mechanisms .

  • Screening platforms: Develop assays to screen for compounds that might rescue function in the context of specific mutations. For example, mutations that lead to assembly/stability defects might be targeted differently than those affecting proton translocation.

  • Therapeutic strategy development: Investigate approaches such as:

    • Targeting reactive oxygen species (ROS) production, which is often enhanced in MT-ATP6 mutants

    • Exploring metabolic bypass strategies to compensate for ATP deficiency

    • Testing mitochondrial-targeted small molecules that could stabilize mutant ATP synthase

The search results indicate that different mutations in MT-ATP6 can lead to variable bioenergetic deficits (from 70% to 90% drop in ATP production) through mechanisms including blocked proton translocation, less efficient coupling, or defects in assembly/stability . This variety suggests that personalized therapeutic approaches based on specific mutation mechanisms may be necessary.

What insights can comparative analysis of MT-ATP6 across species provide for evolutionary biology and adaptation studies?

Comparative analysis of MT-ATP6 across species offers valuable insights into evolutionary biology and adaptation:

  • Thermal adaptation: Studies of ATP6 in Antarctic fish (Notothenioidei) revealed an alternative start codon (GTG instead of ATG) that could be related to higher thermal stability and altered expression, suggesting adaptation to extreme cold environments .

  • Functional conservation vs. sequence variation: Despite variations in primary sequence, the core functional elements of ATP6 remain conserved across species, highlighting evolutionary constraints on this essential protein .

  • Evolutionary origins: Structural studies indicate that subunit 8 (which interacts with ATP6) is an evolutionary vestige of bacterial subunit b that remained mtDNA encoded, providing insights into the endosymbiotic origin of mitochondria .

  • Adaptation to different energetic demands: Species with different metabolic requirements may show specific adaptations in their ATP synthase components, including MT-ATP6.

To conduct such comparative analyses, researchers should:

  • Perform comprehensive sequence alignments across diverse species

  • Analyze codon usage patterns and selection pressures

  • Map sequence variations onto structural models to identify potentially adaptive changes

  • Correlate molecular differences with physiological or environmental adaptations

  • Use phylogenetic approaches to trace the evolutionary history of specific features

The search results suggest that tools like NJ-phylogenetic trees (Clustal omega) have been used to analyze the relatedness of ATP6 protein sequences across vertebrate species .

What are the latest methodological advances in studying ATP synthase proton transport mechanisms, and how can they be applied to MT-ATP6 research?

Recent methodological advances have significantly enhanced our understanding of ATP synthase proton transport mechanisms:

  • High-resolution cryo-EM structures: Recent publications have provided detailed structures of complete ATP synthases from various organisms, including Y. lipolytica and S. cerevisiae, allowing precise mapping of the proton translocation pathway and identification of key functional residues . These structures reveal the arrangement of transmembrane helices in subunit a and their relationship to the c-ring.

  • Site-directed mutagenesis coupled with functional assays: Systematic mutation of key residues followed by functional characterization has helped define the roles of specific amino acids in the proton transport mechanism.

  • Computational simulations: Molecular dynamics simulations can model proton movement through the half-channels in subunit a and predict the effects of mutations on this process.

  • Single-molecule techniques: Methods to observe rotary motion and conformational changes in individual ATP synthase molecules have provided dynamic insights into the coupling between proton movement and mechanical rotation.

Application to MT-ATP6 research:

  • Researchers can create homology models of Coturnix coturnix japonica MT-ATP6 based on available structures

  • Key residues involved in proton transport can be identified and targeted for mutagenesis

  • The effects of naturally occurring or artificially introduced mutations on proton transport can be assessed using proton pumping assays

  • Comparative analysis of proton transport efficiency across species might reveal adaptations to different physiological demands

The search results suggest that the combination of structural information with functional studies has been particularly powerful in understanding how disease-causing mutations in MT-ATP6 affect ATP synthase function .

What are the recommended quality control parameters for recombinant MT-ATP6 preparations?

Based on the search results and standard practices in protein biochemistry, the following quality control parameters are recommended for recombinant MT-ATP6 preparations:

  • Purity assessment: Analysis by SDS-PAGE to ensure purity greater than 90%, as indicated for commercially available recombinant preparations .

  • Protein concentration determination: Accurate quantification of protein concentration using appropriate methods for membrane proteins (e.g., modified Bradford or BCA assays that account for detergent interference).

  • Integrity verification: Western blot analysis using antibodies specific to MT-ATP6 or the tag used for purification to confirm the presence of full-length protein.

  • Structural integrity: Secondary structure analysis using circular dichroism (CD) spectroscopy to verify proper folding, particularly important for membrane proteins.

  • Functional assessment: Development of assays to verify that the recombinant protein retains expected functional properties, such as lipid binding or protein-protein interactions relevant to ATP synthase assembly.

  • Stability testing: Monitoring protein stability under different storage conditions and after freeze-thaw cycles to establish optimal handling procedures, as commercial preparations recommend avoiding repeated freeze-thaw cycles .

  • Contamination testing: Verification of the absence of endotoxins or other contaminants that could interfere with downstream applications, especially for functional studies.

For storage, recombinant MT-ATP6 preparations should be maintained in appropriate buffers (e.g., Tris-based buffer with 50% glycerol at pH 8.0) and stored at -20°C or -80°C for long-term preservation, with working aliquots kept at 4°C for up to one week to avoid freeze-thaw damage .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.