Recombinant Coturnix coturnix japonica Cytochrome c oxidase subunit 2 (MT-CO2)

Shipped with Ice Packs
In Stock

Description

What is Recombinant Coturnix coturnix japonica Cytochrome c Oxidase Subunit 2 (MT-CO2)?

Cytochrome c oxidase subunit 2 (MT-CO2), also known as Cytochrome c oxidase polypeptide II, is a protein subunit of the cytochrome c oxidase enzyme complex, which is essential for cellular respiration . In Coturnix coturnix japonica, or Japanese quail, MT-CO2 plays a critical role in the electron transport chain within the mitochondria .

Recombinant MT-CO2

Recombinant MT-CO2 refers to the protein produced through recombinant DNA technology. This involves isolating the gene encoding MT-CO2 from Coturnix coturnix japonica, cloning it into a suitable expression vector, and expressing it in a host organism such as E. coli . The recombinant protein can then be purified for various research and industrial applications .

Significance of MT-CO2 in Japanese Quail

  • Heat Stress Studies: Research has shown that heat stress can affect the blood acid-base equilibrium and electrolyte balance in Japanese quail, which can influence eggshell quality and enzyme functions .

  • Blood Physiology: Studies on Japanese quail have examined blood gases, electrolytes, hematocrit, and hemoglobin levels under different environmental conditions, providing insights into their physiological responses .

  • Genetic Studies: MT-CO2 is a mitochondrial gene, and variations in this gene can be used to study the genetic diversity and evolution of Japanese quail populations .

Properties of Recombinant MT-CO2

PropertyDescription
SourceE. coli
TagHis (N-terminal)
Protein LengthFull Length (1-227 aa for Arvicanthis somalicus)
FormLyophilized powder
AA SequenceMAYPFQLGLQDATSPIMEELTNFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQE VETIWTILPAAILILIALPSLRILYMMDEINNPVLTVKTMGHQWYWSYEYTDYEDLCFDS YMIPTNDLKPGELRLLEVDNRVVLPMELPIRMLISSEDVLHSWTVPSLGLKTDAIPGRLN QATLSSNRPGLYYGQCSEICGSNHSFMPIVLEMVPLKYFENWSTSMI (Arvicanthis somalicus)
PurityGreater than 90% as determined by SDS-PAGE
StorageStore at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles .
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
ReconstitutionReconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃ .
Gene NameMT-CO2
SynonymsMT-CO2; COII; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
UniProt IDQ38S26 (Arvicanthis somalicus)

Note: The information in this table is based on recombinant MT-CO2 from Arvicanthis somalicus (Neumann's grass rat), as specific data for recombinant Coturnix coturnix japonica MT-CO2 was not available in the given search results. The general properties should be similar, but sequence and specific details may vary .

Effects of Environmental Conditions on Japanese Quail Blood Parameters

A study on the effects of multigenerational heat stress on Japanese quail revealed several insights into blood physiology :

  • Experimental Design: Quails were subjected to different treatments: thermoneutral control (TN), thermoneutral siblings (TNS), heat stress (HS), and heat-stressed siblings (HSS) .

  • Temperature Conditions: Thermoneutral conditions were maintained at 22.2°C, while heat stress was induced at 31.1°C .

  • Measured Parameters: Body weights, blood gases, and electrolytes were measured during acute (first 4 hours) and chronic (3 weeks) heat exposure .

  • Key Findings:

    • Acute and chronic heat stress did not significantly affect blood electrolytes, acid-base regulation, and oxygen transport .

    • Acute HSS males and females showed significant differences compared to chronic TN males in body weight, PCO2, PO2, sO2, and Na+ .

    • Sexually mature males had higher hematocrit and hemoglobin levels than sexually immature quail and sexually mature females .

  • Glucose Levels: Chronic TNS females had the highest glucose levels, possibly due to lower energy demand compared to heat-stressed groups .

  • Hematocrit and Hemoglobin: Males during chronic exposure showed significantly higher levels of hematocrit and hemoglobin, potentially linked to testosterone effects .

Heat Stress and Blood Acid-Base Balance

  • CO2 Loss: Excess loss of CO2 can lead to decreased PCO2 and H2CO3 in the blood, with the kidneys compensating by increasing HCO3- release and reducing H+ excretion .

  • Observed Changes: A study found lower blood PCO2 in acute HS male and female quails, suggesting increased CO2 loss and less adaptation to 31.1°C compared to HSS groups .

  • Resilience: Japanese quails exhibit resilience to heat stress, with only minor changes in acid-base balance observed at 31.1°C, suggesting that higher temperatures may be needed to elicit significant physiological changes .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference for your consideration.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. To prioritize a specific tag, please inform us during your order placement.
Synonyms
MT-CO2; COII; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Coturnix japonica (Japanese quail) (Coturnix coturnix japonica)
Target Names
Target Protein Sequence
MANHSQLGFQDASSPIMEELVEFHDHALMVALAICSLVLYLLTLMLTQKLSSNTVDAQEV ELIWTILPAIVLVLLALPSLQILYMMDEIEEPDLTLKAIGHQWYWSYEYTDFKDLSFDSY MTPTTDLPQGHFRLLEVDHRIVIPMESPIRIIITADDVLHSWAVPTLGVKTDAIPGRLNQ TSFITTRPGVFYGQCSEICGANHSYMPIVVESTPLKHFETWSSLLSS
Uniprot No.

Target Background

Function
Cytochrome c oxidase subunit 2 (MT-CO2) is a component of cytochrome c oxidase (Complex IV), the terminal enzyme in the mitochondrial electron transport chain (ETC). The ETC, comprising succinate dehydrogenase (Complex II), ubiquinol-cytochrome c oxidoreductase (Complex III), and cytochrome c oxidase (Complex IV), facilitates electron transfer from NADH and succinate to molecular oxygen. This process generates an electrochemical gradient across the inner mitochondrial membrane, driving ATP synthesis. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space are transferred through the CuA center of subunit 2 and heme A of subunit 1 to the binuclear center (heme A3 and CuB) in subunit 1. This binuclear center reduces molecular oxygen to two water molecules, utilizing four electrons from cytochrome c and four protons from the mitochondrial matrix.
Database Links

KEGG: cjo:804666

Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is MT-CO2 and what is its role in Japanese quail physiology?

MT-CO2 (Cytochrome c oxidase subunit II) is a mitochondrially-encoded protein that forms part of the cytochrome c oxidase complex (COX), which is the terminal enzyme of the electron transport chain in the inner mitochondrial membrane. In Japanese quail (Coturnix japonica), as in other vertebrates, this protein plays a crucial role in cellular respiration by catalyzing the reduction of oxygen to water while pumping protons across the membrane, contributing to the electrochemical gradient used for ATP synthesis .

The Japanese quail (Coturnix japonica) is a migratory bird found predominantly in eastern Asia, including Japan, Korea, and China, with specific populations also observed in parts of Russia, India, and Africa . Given their migratory nature and adaptation to different environments, studying their mitochondrial proteins provides insights into bioenergetic adaptations to varying oxygen pressures and environmental conditions.

What are the structural characteristics of Japanese quail MT-CO2?

Japanese quail MT-CO2 is one of the three largest subunits of the cytochrome c oxidase complex that are encoded by mitochondrial DNA . The protein contains highly conserved structural elements essential for electron transfer and oxygen binding. Based on homology with other avian species, the protein has an expected molecular weight of approximately 30 kDa .

The protein contains copper-binding domains that facilitate electron transfer and is characterized by transmembrane domains that anchor it within the inner mitochondrial membrane. Though the exact crystal structure of Japanese quail MT-CO2 has not been definitively established, comparative analysis with other species indicates high conservation of functional domains crucial for enzymatic activity.

How does recombinant MT-CO2 differ from the native protein?

Recombinant MT-CO2 refers to the protein produced through genetic engineering techniques rather than isolated from Japanese quail tissue. The recombinant production process typically involves:

  • Isolation and amplification of the MT-CO2 gene from Japanese quail mtDNA

  • Cloning into an appropriate expression vector

  • Expression in a suitable host system (bacterial, insect, or mammalian cells)

  • Purification using affinity tags and chromatography techniques

The primary differences between recombinant and native MT-CO2 include:

CharacteristicNative MT-CO2Recombinant MT-CO2
SourceIsolated from quail mitochondriaExpressed in heterologous system
PurityOften contains other mitochondrial proteinsHigher purity possible with affinity tags
Post-translational modificationsContains species-specific modificationsMay lack some modifications depending on expression system
Functional stateIntegrated in COX complexTypically produced as individual subunit
AvailabilityLimited by tissue availabilityScalable production possible

Similar approaches for recombinant protein production have been successfully employed for other proteins, such as the C-type lectin from seahorse tissue, where antisera were raised against the recombinant protein for functional analysis .

What expression systems are most suitable for producing functional recombinant Japanese quail MT-CO2?

The optimal expression system for recombinant Japanese quail MT-CO2 depends on several factors, including desired yield, downstream applications, and required post-translational modifications. As a mitochondrial membrane protein, MT-CO2 presents specific challenges for recombinant expression.

Prokaryotic Expression Systems:

  • Escherichia coli: While offering high yields and cost-effectiveness, this system struggles with proper folding of membrane proteins and lacks post-translational modification machinery.

  • Cell-free systems: These can accommodate membrane proteins by including appropriate detergents but lack co-factors needed for proper assembly.

Eukaryotic Expression Systems:

  • Insect cells (Sf9, High Five): These provide improved folding capability for complex proteins and include some post-translational modifications.

  • Mammalian cells (HEK293, CHO): These offer the most complete post-translational modifications but at higher cost and lower yield.

  • Avian expression systems: These may provide the most physiologically relevant environment but are less commonly used.

For functional studies of MT-CO2, insect or mammalian cell expression systems are recommended due to their capacity to properly fold membrane proteins and incorporate them into membranes. Similar approaches have been used for other mitochondrial proteins where both structure and function need to be preserved.

What purification strategies yield the highest activity for recombinant Japanese quail MT-CO2?

Purification of recombinant MT-CO2 requires specialized approaches due to its membrane-associated nature:

  • Solubilization: The choice of detergent is critical. Mild detergents like n-dodecyl β-D-maltoside (DDM) or digitonin are preferred to maintain native protein conformation.

  • Affinity Chromatography:

    • His-tag affinity purification using immobilized metal affinity chromatography (IMAC)

    • Strep-tag purification for higher purity

    • Antibody-based affinity chromatography using anti-MT-CO2 antibodies

  • Size Exclusion Chromatography: For further purification and removal of protein aggregates while maintaining the protein in its detergent-solubilized state.

  • Activity Preservation: Include stabilizing agents like glycerol (10-20%) and reducing agents to prevent oxidation of critical residues.

The success of purification can be evaluated through:

  • Western blot analysis using specific antibodies

  • 2D electrophoresis to assess purity and post-translational modifications

  • Activity assays measuring electron transfer capability

Similar purification approaches have been successfully employed for other mitochondrial membrane proteins, as demonstrated in studies utilizing Western analysis and 2D electrophoresis for protein characterization .

How can researchers assess the functional integrity of recombinant MT-CO2?

Assessment of recombinant MT-CO2 functional integrity requires multiple complementary approaches:

Spectroscopic Analysis:

  • Absorption spectra to verify correct incorporation of cofactors

  • Circular dichroism to assess secondary structure integrity

Enzymatic Activity Assays:

  • Oxygen consumption measurements in reconstituted systems

  • Electron transfer rate measurements using artificial electron donors/acceptors

  • Polarographic analysis of cytochrome c oxidation

Structural Verification:

  • Limited proteolysis to assess proper folding

  • Thermal shift assays to evaluate protein stability

  • Native gel electrophoresis to analyze oligomeric state

Integration Assessment:

  • Liposome incorporation experiments

  • Reconstitution with other COX subunits to assess complex formation

A comprehensive assessment involves comparing the recombinant protein's properties with those of the native protein isolated from Japanese quail mitochondria. Functional assays should include positive controls using well-characterized COX proteins from model species.

What factors should be considered when designing experiments to study MT-CO2's role in avian respiratory adaptation?

When investigating MT-CO2's role in avian respiratory adaptation, several experimental design factors should be considered:

Biological Variability and Controls:

  • Use of multiple quail populations to account for genetic variability, as demonstrated in CO₂ response studies where different populations showed variable responses to identical treatments

  • Inclusion of both genders, as gender-specific differences have been documented in respiratory responses

  • Age-matched controls to account for developmental differences

  • Proper statistical power calculations to determine sample size

Environmental Parameters:

  • Control for variations in ambient temperature and oxygen levels

  • Standardization of housing conditions when working with live birds

  • Consideration of developmental exposures, as embryonic exposures to CO₂ have been shown to affect adult ventilatory responses in Japanese quail

Methodological Approaches:

  • Combination of in vivo and in vitro approaches

  • Cross-species comparisons with other Coturnix species for evolutionary insights

  • Integration of physiological measurements with molecular analysis

Research by Szdzuy and Mortola has demonstrated that Japanese quail exhibits developmental plasticity in hypercapnic ventilatory response, with females showing greater adaptability than males, highlighting the importance of considering both genetic and gender factors in experimental design .

How can researchers effectively study the interaction between recombinant MT-CO2 and other subunits of the cytochrome c oxidase complex?

Studying the interactions between recombinant MT-CO2 and other COX subunits requires sophisticated methodological approaches:

Co-expression Systems:

  • Dual or multi-cistronic expression vectors for simultaneous production of multiple subunits

  • Cell lines with knockout/knockdown of endogenous MT-CO2 to prevent interference

Interaction Analysis Techniques:

  • Co-immunoprecipitation using subunit-specific antibodies

  • Blue Native PAGE (BN-PAGE) to analyze intact complexes, a technique successfully employed for mitochondrial proteins

  • Surface plasmon resonance (SPR) to measure binding kinetics

  • Förster resonance energy transfer (FRET) for analyzing proximity of subunits

  • Cross-linking mass spectrometry to identify interaction interfaces

Functional Reconstitution:

  • Stepwise assembly of COX complex components in lipid nanodiscs

  • Activity measurements at each stage of assembly

  • Electron microscopy of reconstituted complexes

Computational Approaches:

  • Molecular dynamics simulations of subunit interactions

  • Sequence analysis across species to identify co-evolving residues

  • Structural modeling based on homologous proteins

Understanding these interactions is crucial as the cytochrome c oxidase complex functions as an integrated unit of 13 subunits, with the mitochondrially-encoded subunits (including MT-CO2) forming the catalytic core of the enzyme .

How should researchers analyze species-specific variations in MT-CO2 between Japanese quail and other birds?

Analyzing species-specific variations in MT-CO2 requires a comprehensive approach combining multiple methods:

Sequence Analysis Approaches:

  • Multiple sequence alignment of MT-CO2 across avian species

  • Calculation of conservation scores for functional domains

  • Identification of positively selected residues using dN/dS ratio analysis

  • Ancestral sequence reconstruction to track evolutionary changes

Structural Comparison:

  • Homology modeling based on crystal structures from other species

  • Mapping of variable residues onto 3D models to identify surface vs. core variations

  • Analysis of variations near functional sites (metal binding, proton channels)

Statistical Analysis Framework:

  • Proper phylogenetic correction for comparative analyses

  • Employment of both maximum likelihood and Bayesian approaches

  • Consideration of environmental factors as covariates

Functional Validation:

  • Site-directed mutagenesis to introduce species-specific residues

  • Activity assays comparing wild-type and mutant proteins

  • Thermal stability analysis to assess adaptive changes

  • Kinetic measurements under varying oxygen concentrations

The Japanese quail's migratory behavior, with seasonal movements covering 400-1000 km , suggests potential adaptations in mitochondrial function for varying altitudes and oxygen concentrations, which may be reflected in MT-CO2 sequence and functional adaptations.

What are the common pitfalls in interpreting functional studies of recombinant MT-CO2 and how can they be avoided?

Functional studies of recombinant MT-CO2 present several interpretation challenges:

Reconstitution Artifacts:

  • Pitfall: Incomplete or improper reconstitution into membranes

  • Solution: Use multiple reconstitution methods and lipid compositions; validate with native membrane controls

Detergent Effects:

  • Pitfall: Residual detergents affecting activity measurements

  • Solution: Include detergent-only controls; employ detergent removal methods prior to assays

Expression System Biases:

  • Pitfall: Post-translational modifications differing from native protein

  • Solution: Compare multiple expression systems; validate key findings with native protein

Assembly Status:

  • Pitfall: Recombinant MT-CO2 functioning differently in isolation versus in complex

  • Solution: Perform studies with both isolated MT-CO2 and reconstituted COX complex

Data Normalization Challenges:

  • Pitfall: Different metrics for protein quantification leading to activity miscalculations

  • Solution: Use multiple quantification methods; normalize to internal standards

Environmental Parameter Control:

  • Pitfall: Activity variations due to uncontrolled pH, temperature, or ionic strength

  • Solution: Systematic variation of parameters; buffers mimicking physiological conditions

Statistical Interpretation:

  • Pitfall: Overinterpretation of small differences

  • Solution: Appropriate statistical tests with corrections for multiple comparisons

How can recombinant MT-CO2 studies inform our understanding of Japanese quail adaptation to hypoxic conditions?

Recombinant MT-CO2 studies can provide significant insights into Japanese quail adaptation to hypoxia through multiple research approaches:

Molecular-Physiological Correlations:

  • Studying kinetic properties of MT-CO2 variants under varying oxygen tensions

  • Correlating MT-CO2 sequence variants with high-altitude adapted populations

  • Examining oxygen affinity differences between lowland and highland quail variants

Developmental Perspectives:

  • Investigating how embryonic exposure to hypoxia affects MT-CO2 expression and function

  • Analyzing potential epigenetic modifications of the MT-CO2 gene in response to developmental hypoxia

Comparative Performance Metrics:
The table below summarizes key parameters that can be measured:

ParameterNormal Oxygen ConditionHypoxic ConditionMeasurement Method
Oxygen affinityBaseline KmPotentially lower KmOxygen electrode
Electron transfer rateStandard ratePotentially modifiedSpectrophotometric assay
Proton pumping efficiencyStandard P/O ratioPotentially alteredpH monitoring, ATP synthesis
ROS productionBaselinePotentially increasedFluorescent probes
Thermal stabilityStandard TmPotentially alteredDifferential scanning fluorimetry

Integrated Physiological Context:
Japanese quail undertake migrations covering 400-1000 km , which is remarkable for a bird not known for sustained flight capabilities. This suggests specialized adaptations in their respiratory and metabolic systems, potentially including modifications in MT-CO2 function to optimize oxygen utilization under varying conditions.

Research has shown that Japanese quail exhibits developmental plasticity in their ventilatory responses, with hypoxic or hypercapnic conditions during embryonic development affecting adult respiratory functions . These whole-organism adaptations likely involve changes at the molecular level, including potential modifications in MT-CO2 structure or regulation.

What methodological approaches best integrate recombinant protein studies with whole-organism physiology in Japanese quail?

Integrating recombinant protein studies with whole-organism physiology requires multi-level research approaches:

Transgenic and Gene Editing Approaches:

  • CRISPR/Cas9 modification of MT-CO2 in quail embryos to introduce specific variants

  • Development of cell lines from different quail tissues expressing modified MT-CO2

  • Creation of heteroplasmic mitochondrial models with mixed wild-type and variant MT-CO2

Tissue-Specific Expression Analysis:

  • Quantitative comparison of MT-CO2 expression across tissues with varying metabolic demands

  • Correlation of expression patterns with tissue-specific oxygen consumption rates

  • Histological techniques to visualize mitochondrial distribution in high-energy tissues

Ex Vivo Approaches:

  • Isolated organ preparations (heart, muscle) to measure functional impacts of MT-CO2 variants

  • Primary cell cultures from different quail tissues to study tissue-specific effects

  • High-resolution respirometry of tissue samples from quail with different MT-CO2 variants

In Vivo Physiological Measurements:

  • Whole-body metabolic rate determination using respirometry

  • Exercise capacity testing under normoxic and hypoxic conditions

  • Thermal challenge responses to assess mitochondrial flexibility

Multi-Omics Integration:

  • Correlation of MT-CO2 variants with transcriptomic, proteomic, and metabolomic profiles

  • Network analysis to identify compensatory mechanisms associated with MT-CO2 variations

  • Flux analysis to determine whole-pathway effects of MT-CO2 modifications

Studies on Japanese quail have demonstrated that developmental exposures can have lasting effects on adult respiratory physiology, with female quail showing greater developmental plasticity in hypercapnic ventilatory responses than males . This suggests that integrated studies should consider both developmental timing and gender-specific effects when analyzing MT-CO2 function in the context of whole-organism physiology.

What are the most promising future research directions for Japanese quail MT-CO2 studies?

The study of recombinant Japanese quail MT-CO2 offers several promising research avenues:

Evolutionary Adaptations:

  • Comparative analysis across Coturnix species to identify adaptive molecular changes

  • Investigation of MT-CO2 variants in migratory versus non-migratory quail populations

  • Reconstruction of ancestral sequences to trace the evolution of functional adaptations

Climate Change Implications:

  • Assessment of MT-CO2 function under projected temperature increases

  • Analysis of adaptive capacity to changing oxygen and CO₂ levels

  • Multigenerational studies to determine epigenetic adaptation potential

Mitochondrial Disease Models:

  • Development of quail models expressing human MT-CO2 disease variants

  • Therapeutic testing of compounds that may rescue MT-CO2 dysfunctions

  • Cross-species comparison of disease susceptibility and compensatory mechanisms

Bioenergetic Optimization:

The Japanese quail represents an excellent model organism for these studies due to its manageable size, relatively short generation time, and well-documented physiological adaptability to environmental changes, as evidenced by studies showing developmental plasticity in ventilatory responses . Additionally, the close relationship but distinct speciation from European Common Quail (Coturnix coturnix) provides valuable comparative material for evolutionary studies .

How can contradictory research findings about MT-CO2 function be reconciled through improved methodological approaches?

Contradictory findings in MT-CO2 research can be addressed through several methodological improvements:

Standardization of Experimental Conditions:

  • Development of consensus protocols for recombinant expression and purification

  • Standardized activity assay conditions to enable direct comparison between studies

  • Centralized repository of validated reagents (antibodies, plasmids, cell lines)

Multi-Laboratory Validation:

  • Collaborative studies with identical protocols across multiple laboratories

  • Blind testing of samples by independent research groups

  • Pre-registration of experimental designs to reduce publication bias

Comprehensive Study Designs:

  • Inclusion of multiple quail populations to account for genetic variation

  • Gender-balanced experimental groups to detect sex-specific effects

  • Developmental timing considerations as developmental exposures can create lasting effects

Integration of Methods:

  • Combination of in vitro biochemistry with in vivo physiological measurements

  • Parallel studies using both recombinant and native proteins

  • Multi-omics approaches to place MT-CO2 function in broader biological context

Advanced Statistical Approaches:

  • Meta-analysis of published data with correction for methodological variations

  • Bayesian approaches to incorporate prior knowledge and uncertainty

  • Power analysis to ensure adequate sample sizes for detecting biologically relevant effects

Research on Japanese quail ventilatory responses has demonstrated that identical treatments can produce different outcomes in different populations of quail, highlighting the importance of genetic background in experimental design . Similarly, gender differences in response to developmental exposures emphasize the need for balanced experimental groups that can detect sex-specific effects.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.