Recombinant Coupling protein TraD (traD)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Coupling Protein TraD (traD)

Recombinant Coupling protein TraD (traD) is a crucial component in bacterial conjugation, the process by which DNA is transferred between bacteria . It belongs to the TraG protein family, which includes TraG in RP4 and TrwB in R388, found in various conjugative plasmids of gram-negative bacteria, as well as VirD4 in the Agrobacterium tumefaciens T-DNA transfer system . These proteins share significant amino acid sequence similarities, transmembrane domains, and sequence signatures for nucleoside triphosphate binding .

Function of TraD

TraD, a coupling protein, is essential for conjugation but not directly involved in mating-pair formation (Mpf) or conjugative DNA processing . It acts as a connector between the relaxosome, a nucleoprotein complex for conjugative DNA processing at oriT, and the membrane-spanning protein complex responsible for DNA translocation, which is encoded by Mpf genes .

TraD and Relaxosome Interactions

TraD interacts with different components of the F-plasmid relaxosome, as suggested by both in vivo and in vitro studies . It has been shown to interact with TraI in vivo and with TraM in vitro . The carboxyl terminus of TraD plays a role in determining the specificity of interaction with relaxosomes from various conjugative and mobilizable plasmids .

Impact of Carboxyl Terminus Deletion on TraD Function

Studies involving the deletion of amino acids in the carboxyl terminus of TraD have demonstrated altered specificity in its interactions with relaxosomes of different plasmids . Removing a portion of the carboxyl terminus can broaden the range of mobilizable relaxosomes but reduce the efficiency of F-plasmid transfer . For instance, deleting the last 140 amino acids of TraD (creating TraD576) enhances the mobilization of RSF1010 by Mpf F, increasing it 1,000-fold compared to the full-length TraD .

Oligomerization of TraD

Research indicates that TraD forms stable oligomeric complexes in bacterial membranes, a process influenced by other F-encoded functions . Different regions of TraD play distinct roles in the oligomerization process, as suggested by studies using tagged mutants and various biochemical techniques .

TraD in Protein Expression Systems

TraD can be utilized within Escherichia coli strains and plasmids to manipulate protein expression . The CYR1 mutation, for example, can increase a strain's thermotolerance and its capacity to produce high yields of recombinant protein . Cell-free transcription/translation systems, such as TnT Quick Coupled Transcription/Translation Systems, provide a convenient method for eukaryotic cell-free protein expression .

Chemical Conjugation and TraD

Chemical conjugation strategies targeting native amino acids in proteins are relevant in the context of antibody-drug conjugates . While TraD itself isn't directly used as an antibody-drug conjugate, understanding protein conjugation techniques is crucial in modifying and utilizing proteins like TraD in various applications .

Tables and Figures

PlasmidDescription
RSF1010A mobilizable plasmid that relies on the mating pair formation (Mpf) and coupling protein provided by a conjugative plasmid for its transfer .
ColE1Another mobilizable plasmid, similar to RSF1010, which requires a conjugative plasmid to supply the necessary functions for transfer .
F plasmidA conjugative plasmid that carries all the functions needed for its own transfer, including the gene for the coupling protein TraD, which facilitates the connection between the relaxosome and the membrane-spanning protein complex for DNA translocation .
R388A conjugative plasmid that encodes the coupling protein TrwB, which is functionally analogous to TraD in the F plasmid and TraG in RP4, facilitating the transfer of the plasmid DNA during conjugation .
RP4A conjugative plasmid that encodes the coupling protein TraG, which is essential for its conjugative transfer. TraG, like TraD and TrwB, plays a critical role in linking the DNA-processing machinery to the mating pair-forming apparatus, enabling the plasmid to move between bacteria .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is finalized during production. If you require a specific tag, please inform us for preferential development.
Synonyms
traD; Coupling protein TraD; DNA transport protein TraD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-738
Protein Length
full length protein
Species
Escherichia coli
Target Names
traD
Target Protein Sequence
MSFNAKDMTQGGQIASMRIRMFSQIANIMLYCLFIFFWILIGLVLWVKISWQTFINGCIY WWCTSLEGMRDLIKSQPVYEIQYYGKTFRMNAAQVLHDKYMIWCGEQLWSAFVLASVVAL VICLITFFVVSWILGRQGKQQSENEVTGGRQLTDNPKDVARMLKKDGKDSDIRIGDLPII RDSEIQNFCLHGTVGAGKSEVIRRLANYARQRGDMVVIYDRSGEFVKSYYDPSIDKILNP LDARCAAWDLWKECLTQPDFDNTANTLIPMGTKEDPFWQGSGRTIFAEAAYLMRNDPNRS YSKLVDTLLSIKIEKLRTFLRNSPAANLVEEKIEKTAISIRAVLTNYVKAIRYLQGIEHN GDPFTIRDWMRGVREDQKNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV WFFCDELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGEKAAATLFDVMNTRA FFRSPSHKIAEFAAGEIGEKEHLKASEQYSYGADPVRDGVSTGKDMERQTLVSYSDIQSL PDLTCYVTLPGPYPAVKLSLKYQARPKVAPEFIPRDINPEMENRLSAVLAAREAEGRQMA SLFEPEVASGEDVTQAEQPQQPQQPQQPQQPQQPQQPQQPQQPQQPVSSVINDKKSDAGV SVPAGGIEQELKMKPEEEMEQQLPPGISESGEVVDMAAYEAWQQENHPDIQQHMQRREEV NINVHRERGEDVEPGDDF
Uniprot No.

Target Background

Function
Conjugative DNA transfer (CDT) is the unidirectional transfer of single-stranded DNA (ssDNA) plasmids from a donor to a recipient cell. It is the primary mechanism for the spread of antibiotic resistance and virulence factors within bacterial populations. TraD couples the transferosome to a type IV secretion system, likely forming a pore for ssDNA plasmid transfer to the secretion system. Plasmid specificity is determined by the TraD-TraM protein pair.
Protein Families
TrwB coupling protein family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is coupling protein TraD and what is its functional role in bacterial conjugation?

Coupling protein TraD belongs to the TraG protein family and is an essential component of type IV secretion systems found in plant, animal, and human pathogens. TraD plays a critical role in bacterial conjugation by connecting the DNA-processing machinery (relaxosome) to the mating pair-forming (Mpf) transfer apparatus . This protein serves as an integral inner membrane linker that facilitates the transfer of DNA from donor to recipient cells. Unlike other proteins involved in conjugation, TraD is not directly involved in mating-pair formation or DNA processing but is specifically responsible for connecting these two functional components .

TraD contains transmembrane domains and nucleoside triphosphate binding sequence signatures, suggesting its role in energy provision for the DNA transfer process . In the F-like plasmid system, TraD is essential for conjugative DNA transfer, and without it, even if all other transfer components are present, DNA transfer cannot occur .

How does the structure of TraD relate to its function?

TraD has a complex structure that reflects its specialized function. The protein contains N-terminal transmembrane domains that anchor it to the inner membrane, while the large C-terminal domain extends into the cytoplasm where it can interact with the relaxosome components . Research has identified that TraD's structure contains several critical regions:

  • N-terminal transmembrane domains: These anchor the protein to the bacterial inner membrane

  • Central cytoplasmic domain: Contains nucleoside triphosphate binding motifs that likely provide energy for the transfer process

  • C-terminal domain: The last 38 amino acids are particularly important for specific protein-protein interactions

The cytoplasmic portion of TraD is quite large compared to the membrane-spanning region, which allows it to interact efficiently with cytoplasmic components of the relaxosome, particularly the TraM protein . When the C-terminal 38 amino acids are removed from TraD, the protein loses its ability to bind to TraM, indicating that this region is essential for the protein-protein interaction that facilitates DNA transfer .

What is known about the interaction between TraD and TraM proteins?

The interaction between TraD and TraM is critical for conjugative DNA transfer. Research using multiple methods has conclusively demonstrated that:

  • TraD interacts specifically with the relaxosomal protein TraM both in vitro and in vivo

  • The C-terminal 38 amino acids of TraD constitute the major TraM interaction domain

  • The TraD-TraM interaction occurs whether TraM is free or in complex with its target DNA

  • The apparent association constant (kA) for the interaction between truncated TraD (TraD11) and MBP-TraM was calculated to be 2.6 × 10^7 liters/mol, indicating a strong binding affinity

Experimental evidence from overlay assays, enzyme-linked immunosorbent assays (ELISAs), and electrophoretic mobility shift assays all confirm this interaction . Additionally, in vivo conjugation assays demonstrated that overexpression of just the 38 amino-acid C-terminal fragment of TraD (termed TraD15) exerted a dominant negative effect on DNA transfer by competing with full-length TraD for TraM binding . This confirms that the TraD-TraM interaction is essential for conjugative DNA transfer but not for phage infection, as TraD15 did not affect infection by pilus-specific phage R17 .

How do mutations in the C-terminal domain of TraD affect conjugation efficiency and specificity?

Mutations in the C-terminal domain of TraD significantly impact both the efficiency and specificity of conjugative DNA transfer. Research has demonstrated that:

When the C-terminal 140 amino acids of TraD are deleted (creating TraD576), the protein's specificity of interaction with different relaxosomes is altered . This truncated version results in a broadened range of mobilizable relaxosomes that can be recognized, but at the expense of decreased efficiency in F-plasmid transfer . The carboxyl terminus of TraD appears to add specificity and efficiency to the conjugation process.

Experimental evidence shows that removing the last 38 amino acids from TraD completely abolishes its ability to bind to TraM, demonstrating that this region contains the main TraM interaction domain . Without this interaction, conjugative DNA transfer is severely impaired, highlighting the essential nature of this protein-protein interaction for efficient conjugation .

The specificity alterations observed with C-terminal mutations suggest that the TraD C-terminus plays a role in substrate selection within conjugation systems. This is particularly relevant when considering plasmid compatibility and the mobilization of different plasmids by a single conjugation system .

What experimental methods are most effective for studying TraD-TraM interactions?

Based on the research literature, several experimental approaches have proven effective for studying TraD-TraM interactions:

  • Overlay Assays: These have been successfully used to demonstrate binding between TraD variants and TraM. In this approach, purified TraD proteins are separated by SDS-PAGE, transferred to nitrocellulose, and then overlaid with purified TraM or MBP-tagged TraM. The interaction is detected using anti-TraM or anti-MBP antisera .

  • Enzyme-Linked Immunosorbent Assays (ELISAs): These provide quantitative data on binding affinity. TraD variants are bound to the surface of 96-well plates and incubated with increasing concentrations of MBP-TraM. The binding curves generated from this data allow for calculation of association constants .

  • Electrophoretic Mobility Shift Assays: These assays demonstrate whether TraD variants can bind to TraM when it is in complex with its target DNA, which is important for understanding the functional relevance of the interaction in the context of the relaxosome .

  • In vivo Conjugation Assays: By overexpressing TraD fragments (such as TraD15) in donor cells containing conjugative plasmids, researchers can observe dominant negative effects on conjugation frequency, providing evidence for in vivo interaction between TraD and TraM .

  • Site-Directed Mutagenesis: This approach allows for precise modification of TraD, enabling the analysis of specific domains or amino acids. For example, introducing stop codons to create truncated versions of TraD has been valuable for defining the importance of the C-terminal domain .

A combination of these methods provides the most comprehensive understanding of TraD-TraM interactions and their importance in conjugative DNA transfer.

What is the significance of substrate selection in conjugative transfer systems?

Substrate selection in conjugative transfer systems is crucial for maintaining plasmid specificity and compatibility within bacterial communities. The research on TraD provides important insights into this process:

The carboxyl terminus of TraD adds specificity to the conjugation process. When this region is deleted, the protein exhibits broader recognition of mobilizable relaxosomes but with reduced efficiency for its native plasmid transfer . This suggests that the C-terminus has evolved to optimize interaction with specific relaxosomes.

Understanding substrate selection mechanisms is important for several reasons:

  • It explains how different plasmids can coexist within the same bacterial cell without interference in their transfer systems

  • It provides insights into how mobilizable plasmids can exploit conjugative machinery

  • It offers potential strategies for controlling horizontal gene transfer, which has implications for antibiotic resistance spread

The research indicates that the coupling protein-relaxosome interaction represents a critical checkpoint in determining which DNA molecules are transferred during conjugation, making it an important target for both basic research and potential applications in controlling bacterial gene transfer .

How can recombinant TraD proteins be expressed and purified for in vitro studies?

Based on the research literature, successful expression and purification of recombinant TraD proteins involves several key approaches:

Expression Systems and Constructs:

  • N-terminally truncated versions of TraD (such as TraD11 and TraD21) missing the transmembrane domains have been successfully expressed

  • Fusion tags such as Calmodulin Binding Protein (CBP) have been used to facilitate purification

  • TraD fragments comprising specific domains (like TraD15, containing just the 38 C-terminal amino acids) can be expressed for domain-specific studies

Purification Strategy:

  • Affinity purification using appropriate tag-based systems (CBP-tagged proteins can be purified using calmodulin affinity resins)

  • Size exclusion chromatography may be used as a secondary purification step

  • Protein purity should be verified by SDS-PAGE

Considerations for Membrane Proteins:
Since full-length TraD is a membrane protein with transmembrane domains, expression of the complete protein presents challenges. The successful approach in the literature has been to express soluble fragments lacking the membrane-spanning regions . If full-length TraD is required, specialized membrane protein expression systems may be necessary, potentially including:

  • Detergent solubilization methods

  • Membrane mimetics like nanodiscs or liposomes for maintaining native conformation

For functional studies, both the TraD11 (ΔN155) and TraD15 (C-terminal 38 amino acids) constructs have proven valuable in investigating TraM interactions and can serve as useful tools for researchers studying the mechanism of coupling protein function .

What quantitative methods can be used to measure TraD-TraM binding affinity?

Several quantitative methods have been successfully employed to measure the binding affinity between TraD and TraM proteins:

Enzyme-Linked Immunosorbent Assays (ELISAs):

  • This method was used to determine the apparent association constant (kA) for TraD11 and MBP-TraM interaction at 2.6 × 10^7 liters/mol

  • The procedure involves coating wells with purified TraD variants, incubating with increasing concentrations of MBP-TraM, and detecting bound MBP-TraM with appropriate antibodies

  • Binding curves generated from the data allow for calculation of association constants

Potential Additional Methods Not Explicitly Mentioned in the Search Results:

  • Surface Plasmon Resonance (SPR):

    • Would allow real-time measurement of binding kinetics

    • Could determine both association (kon) and dissociation (koff) rate constants

    • Would provide KD values that could be compared with the ELISA-derived constants

  • Isothermal Titration Calorimetry (ITC):

    • Would provide thermodynamic parameters of binding (ΔH, ΔS, ΔG)

    • Could offer insights into the energetics of TraD-TraM interaction

  • Microscale Thermophoresis (MST):

    • Would allow measurement of interactions in solution with minimal protein consumption

    • Could be useful for comparing binding affinities across different TraD variants

For TraD-TraM interactions specifically, the ELISA approach has proven successful and provided reliable quantitative data on binding affinity . The high association constant observed (2.6 × 10^7 liters/mol) indicates a strong and specific interaction between these proteins, which aligns with their essential role in conjugative DNA transfer.

How can the function of TraD be assessed in vivo?

In vivo assessment of TraD function can be accomplished through several experimental approaches as demonstrated in the research literature:

Conjugation Frequency Assays:

  • The most direct measure of TraD functionality is through conjugation frequency measurement

  • The protocol involves mixing donor cells containing the conjugative plasmid (expressing TraD) with recipient cells, followed by selection of transconjugants on appropriate media

  • Conjugation frequency is calculated as the number of transconjugants per donor cell

Dominant Negative Approach:

  • Overexpression of TraD fragments (such as TraD15) in donor cells expressing wild-type TraD

  • If the fragment interferes with normal TraD function, a reduction in conjugation frequency will be observed

  • This approach was successfully used to demonstrate that the C-terminal 38 amino acids of TraD interact with TraM in vivo

Specificity Testing:

  • Testing the ability of TraD variants to support transfer of different plasmids

  • This approach revealed that C-terminal deletions in TraD alter its specificity, broadening the range of mobilizable relaxosomes at the expense of decreased efficiency in native plasmid transfer

Phage Infection Assays:

  • Complementary to conjugation assays, these tests can distinguish between TraD functions in conjugation versus pilus assembly

  • For example, TraD15 expression affected conjugative DNA transfer but not infection by pilus-specific phage R17, indicating that TraM-TraD interaction is specifically important for DNA transfer

Combined, these methods provide a comprehensive assessment of TraD function in vivo. The conjugation frequency assay serves as the primary readout, while the other approaches help dissect the mechanism and specificity of TraD's role in the conjugation process.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.