Recombinant Cowpea mosaic virus RNA1 polyprotein

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional charges apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
RNA1 polyprotein; B RNA polyprotein; Bottom component polyprotein; Genome polyprotein B; P1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1156-1866
Protein Length
Full Length of Mature Protein
Species
Cowpea mosaic virus (strain SB) (CPMV)
Target Protein Sequence
GAEEYFDFLPAEENVSSGVAMVAGLKQGVYIPLPTKTALVETPSEWHLDTPCDKVPSILV PTDPRIPAQHEGYDPAKSGVSKYSQPMSALDPELLGEVANDVLELWHDCAVDWDDFGEVS LEEALNGCEGVEYMERIPLATSEGFPHILSRNGKEKGKRRFVQGDDCVVSLIPGTTVAKA YEELEASAHRFVPALVGIECPKDEKLPMRKVFDKPKTRCFTILPMEYNLVVRRKFLNFVR FIMANRHRLSCQVGINPYSMEWSRLAARMKEKGNDVLCCDYSSFDGLLSKQVMDVIASMI NELCGGEDQLKNARRNLLMACCSRLAICKNTVWRVECGIPSGFPMTVIVNSIFNEILIRY HYKKLMREQQAPELMVQSFDKLIGLVTYGDDNLISVNAVVTPYFDGKKLKQSLAQGGVTI TDGKDKTSLELPFRRLEECDFLKRTFVQRSSTIWDAPEDKASLWSQLHYVNCNNCEKEVA YLTNVVNVLRELYMHSPREATEFRRKVLKKVSWITSGDLPTLAQLQEFYEYQRQQGGADN NDTCDLLTSVDLLGPPLSFEKEAMHGCKVSEEIVTKNLAYYDFKRKGEDEVVFLFNTLYP QSSLPDGCHSVTWSQGSGRGGLPTQSWMSYNISRKDSNINKIIRTAVSSKKRVIFCARDN MVPVNIVALLCAVRNKLMPTAVSNATLVKVMENAKAFKFLPEEFNFAFSDV
Uniprot No.

Target Background

Function
This thiol protease cleaves the RNA1 and RNA2 polyproteins, playing a crucial role in RNA replication. It covalently binds to the 5' terminus of both viral single-stranded RNA1 and RNA2 molecules. It downregulates RNA1 polyprotein processing and enhances trans-cleavage of RNA2 polyproteins. The protease cofactor and putative helicase target replication complexes to endoplasmic reticulum (ER) membranes. Their interaction causes ER membrane rearrangement, potentially forming small membranous vesicles serving as sites for viral RNA synthesis. This protease is essential for viral genome replication.
Database Links

KEGG: vg:956628

Protein Families
Comoviridae genome polyprotein B family
Subcellular Location
[Putative helicase]: Host membrane; Single-pass membrane protein. Host cytoplasm, host perinuclear region.; [RNA-directed RNA polymerase]: Host endoplasmic reticulum.; [Protease cofactor]: Host cytoplasm, host perinuclear region.

Q&A

What is the structure and organization of CPMV RNA1 polyprotein?

CPMV RNA1 polyprotein is expressed from a single open reading frame spanning approximately 5,831 nucleotides within the 6kb RNA1 segment. The polyprotein has a molecular weight of approximately 208,000 and is proteolytically cleaved into five mature proteins by the viral 24K protease. The RNA1 polyprotein is organized sequentially as follows:

ProteinApproximate SizePrimary Function
32K32 kDaProteinase cofactor
58K58 kDaPresumed helicase activity
VPgSmall protein5′ linked to genomic RNAs
24K24 kDaViral proteinase
87K87 kDaRNA-dependent RNA polymerase

The processing of this polyprotein is essential for viral replication, with each component playing a distinct role in the virus life cycle .

How does RNA1 polyprotein contribute to CPMV replication?

RNA1 polyprotein contains all proteins necessary and sufficient for viral replication. The 24K protease processes both RNA1 and RNA2 polyproteins into functional components. The 87K protein functions as the RNA-dependent RNA polymerase (RdRp) responsible for viral genome replication. The 58K protein likely functions as a helicase, while the VPg serves as a protein primer for RNA synthesis and remains covalently linked to the 5' end of viral RNAs. The 32K protein serves as a cofactor for proteolytic activity.

Importantly, replication occurs on membranous vesicles derived from the endoplasmic reticulum (ER), with RNA1-encoded proteins 32K and 60K playing crucial roles in targeting the replication complex to these membranes .

What are the preferred methods for expressing recombinant CPMV RNA1 polyprotein for research purposes?

For heterologous expression of RNA1 polyprotein, E. coli-based systems have been successfully employed. Research indicates that high-level synthesis of proteins containing protease and polymerase moieties (110-kDa protein) and polymerase alone (87-kDa protein) can be achieved using specific plasmid constructions.

Methodology details:

  • Clone the CPMV RNA1 polyprotein coding sequence into an appropriate E. coli expression vector

  • Transform into expression strains (BL21(DE3) or similar)

  • Induce protein expression (typically with IPTG)

  • Detect expression through immunoblotting using antisera against precursor polyprotein or specific maturation products

How can researchers isolate and purify RNA1-encoded proteins from infected plant material?

Isolation of RNA1-encoded proteins from infected plant material requires careful fractionation techniques:

  • Cultivate infected Vigna plants in Hoagland solution supplemented with 35S-sulfate for radioactive labeling

  • Harvest and homogenize leaf tissue

  • Fractionate cells to isolate membrane fractions containing virus-specific vesicular structures

  • Extract proteins from these fractions using appropriate detergents

  • Separate proteins by SDS-PAGE

Using this approach, researchers have isolated two virus-specific proteins with molecular weights of approximately 170,000 and 72,000 from infected cells, which correspond to RNA1-encoded proteins .

How can mutations in RNA1 polyprotein be used to study the link between replication and encapsidation?

Researchers have utilized mutations in RNA1 polyprotein to investigate the relationship between viral replication and genome packaging. Studies show that mutations affecting replication have corresponding impacts on encapsidation, demonstrating a functional link between these processes.

Experimental approach:

  • Create specific mutations in RNA1 sequences

  • Assess the effects of these mutations on both replication and packaging

  • Measure viral RNA accumulation and particle formation

Findings indicate that RNA1-mediated replication is required for encapsidation of both RNA1 and RNA2, suggesting that specificity in packaging viral RNAs is achieved through coupling with the replication process. This insight can be exploited to specifically encapsidate custom RNA sequences by placing them between RNA2 sequences required for replication .

What is the role of RNA1-encoded proteins in membrane rearrangements during CPMV infection?

CPMV infection induces extensive rearrangements of host cell membranes, particularly the endoplasmic reticulum (ER). Research shows that specific RNA1-encoded proteins, when expressed individually, can recapitulate aspects of these membrane alterations.

The 32K and 60K proteins have been demonstrated to associate with membranes derived primarily from the ER. When expressed in isolation, particularly the 32K protein and to a lesser extent the 60K protein, they induce proliferation of ER membranes resembling changes observed during CPMV infection.

Key findings:

  • 32K and 60K proteins associate with ER membranes when expressed alone

  • These proteins can induce ER proliferation similar to that observed in viral infection

  • Other RNA1-encoded proteins (110K polymerase and 24K proteinase) behave as soluble proteins when expressed individually

These results suggest that localization signals in 32K and 60K target the replication complexes to ER membranes, causing membrane rearrangements that result in formation of the small membranous vesicles serving as sites for CPMV RNA synthesis .

How do RNA1-encoded proteins interact with host cell components during infection?

RNA1-encoded proteins interact with various host components to facilitate viral replication and modulate cellular functions:

  • Membrane associations: The 32K and 60K proteins associate with ER membranes, inducing their proliferation to create viral replication factories

  • Host defense manipulation: Recent research has identified that cowpea lipid transfer protein 1 (LTP1) specifically interacts with the CPMV 24K protease

  • LTP1 inhibition mechanism: LTP1 inhibits the proteolytic activity of 24K protease both in vitro and in vivo, reducing viral accumulation

  • Subcellular relocalization: Upon infection, host defense proteins like LTP1 redistribute from primarily apoplastic locations to intracellular compartments including chloroplasts

These interactions represent critical virus-host interfaces that influence infection outcomes. For example, overexpression of LTP1 reduces CPMV accumulation and symptoms, while silencing LTP1 increases viral accumulation, demonstrating the significance of these interactions for successful viral infection .

What is the mechanism of 24K protease activity within the RNA1 polyprotein?

The 24K protease encoded by RNA1 is critical for processing both RNA1 and RNA2 polyproteins. Research has elucidated several key aspects of its function:

  • Catalytic mechanism: The 24K protease functions as a cysteine protease with a catalytic triad composed of cysteine-166, histidine-40, and glutamic acid-77

  • Substrate specificity: The protease recognizes specific cleavage sites within the viral polyproteins

  • Co-factor requirement: The 32K protein serves as a cofactor for proteolytic activity

  • Processing sequence: The protease processes polyproteins through both cis and trans cleavage events

Comparative analysis between CPMV and the related Cowpea severe mosaic virus (CPSMV) reveals that of the determined and deduced cleavage sites, only the site at the 24K/87K junction shows distinct amino acid pairs between the two viruses. The VPg and 87K proteins show the highest similarity between these viruses, with identities of 68% and 55% respectively, suggesting evolutionary conservation of these critical functions .

How does structural analysis of CPMV RNA1 polyprotein inform protein engineering applications?

Structural analysis of CPMV RNA1 polyprotein provides valuable insights for protein engineering:

  • Functional domains: Identifying discrete functional domains within the polyprotein allows researchers to express and study individual proteins

  • Protease engineering: Understanding the catalytic mechanism of the 24K protease enables the design of modified proteases with altered specificity

  • Replication module: The RNA1 polyprotein contains a complete replication module that can be potentially harnessed for expressing heterologous sequences

These structural insights have practical applications in developing CPMV as a biotechnological platform. For instance, the understanding of protease processing has allowed the development of expression systems where the RNA2-encoded coat protein precursor (VP60) can be coexpressed with the RNA1-encoded 24K protease to generate empty virus-like particles, useful for various biotechnological applications .

What methods are most effective for studying protein-protein interactions within the RNA1 polyprotein complex?

Several complementary approaches have proven effective for studying protein-protein interactions within the RNA1 polyprotein complex:

  • Co-immunoprecipitation: Using antibodies against specific viral proteins to pull down interaction partners

  • Yeast two-hybrid screening: Identifying binary protein interactions

  • Bimolecular fluorescence complementation: Visualizing protein interactions in plant cells

  • Confocal microscopy with fluorescent protein fusions: Determining co-localization of viral proteins

  • Electron microscopy: Visualizing ultrastructural changes and protein localization at high resolution

For example, researchers have successfully used GFP fusions with RNA1-encoded proteins to track their localization in plant cells. The 32K and 60K proteins were found to associate with ER membranes, while 110K polymerase and 24K protease behaved as soluble proteins when expressed in isolation .

How can researchers overcome challenges in expressing functional RNA1 polyprotein in heterologous systems?

Expressing functional RNA1 polyprotein in heterologous systems presents several challenges:

  • Size limitations: The full RNA1 polyprotein is approximately 208 kDa, making complete expression difficult

  • Proteolytic processing: Proper processing requires active 24K protease and appropriate cofactors

  • Membrane associations: Some components require membrane association for function

  • Host-specific factors: Additional plant-specific factors may be required for full functionality

Recommended strategies:

  • Express individual mature proteins rather than the complete polyprotein

  • Include the 24K protease when expressing precursor proteins requiring processing

  • Incorporate appropriate subcellular targeting signals

  • Consider plant-based expression systems for maintaining proper cellular context

  • Use transient expression through agroinfiltration or virus vectors for in planta studies

Evidence suggests that while E. coli can express RNA1-encoded proteins, these proteins may not exhibit the same functionality as in plant cells. For example, crude lysates from E. coli expressing the 87K polymerase failed to show poly(A)-oligo(U) polymerase activity under conditions where similar systems for poliovirus polymerase were positive .

What are the most sensitive methods for detecting and quantifying RNA1 polyprotein processing intermediates?

Detection and quantification of RNA1 polyprotein processing intermediates require highly sensitive techniques:

  • Immunoblotting with specific antisera: Using antibodies against different regions of the polyprotein enables detection of specific intermediates. For example, anti-VPg antibody recognizes the 170K, 112K, 84K, and 60K proteins, while anti-110K antibody recognizes the 170K, 112K, 87K, and 84K proteins .

  • Mass spectrometry:

    • Liquid chromatography-tandem mass spectrometry (LC-MS/MS)

    • MALDI-TOF analysis of protease digestion products

  • Metabolic labeling:

    • 35S-methionine pulse-chase experiments for tracking processing kinetics

    • 35S-sulfate administration to intact plants for in vivo labeling

  • Fluorescent protein tagging:

    • Fusion of fluorescent reporters to polyprotein segments

    • Real-time visualization of processing using FRET-based reporters

When designing experiments to study polyprotein processing, it's essential to consider the rapid nature of some processing events and the potential accumulation of stable intermediates rather than final cleavage products.

What emerging techniques might advance our understanding of CPMV RNA1 polyprotein function?

Several emerging techniques hold promise for advancing our understanding of CPMV RNA1 polyprotein function:

  • Cryo-electron microscopy: High-resolution structural analysis of RNA1-encoded protein complexes in their native membrane environment

  • Proximity labeling approaches: Using techniques like BioID or APEX to identify proteins in close proximity to RNA1-encoded proteins in infected cells

  • Single-molecule RNA fluorescence in situ hybridization (smFISH): Tracking viral RNA localization in relation to replication complexes

  • CRISPR-Cas-based approaches: Engineering plant host factors to study their interactions with viral proteins

  • Nanobody-based probes: Developing highly specific detection tools for viral protein conformations and interactions

These approaches could help resolve outstanding questions about the temporal and spatial dynamics of RNA1 polyprotein processing, the assembly of replication complexes, and the specific roles of each mature protein in the viral life cycle.

How might understanding RNA1 polyprotein processing inform the development of antiviral strategies?

Understanding RNA1 polyprotein processing could inform novel antiviral strategies:

  • Protease inhibitors: The 24K protease represents a potential target for antiviral development, as inhibiting its activity would prevent the production of functional replication proteins

  • Natural defense mechanisms: The recent discovery that cowpea LTP1 inhibits 24K protease activity suggests that plant-derived protease inhibitors could be developed as antiviral agents

  • Disruption of protein-membrane interactions: Targeting the association of 32K and 60K proteins with ER membranes could prevent the formation of viral replication factories

  • Triggering host defense responses: Exploiting the knowledge that plants respond to viral proteases through specific inhibitory mechanisms

Research has demonstrated that cowpea LTP1 suppresses CPMV accumulation by directly inhibiting viral cysteine protease activity. Heterologous expression of cowpea LTP1 in tobacco plants resulted in significant suppression of infection by soybean mosaic virus, which encodes a similar protease. This finding provides a potential strategy for controlling plant viral diseases by inhibiting viral protease activity using plant-derived protease inhibitors .

How does CPMV RNA1 polyprotein compare to similar proteins in related viruses?

CPMV RNA1 polyprotein shares structural and functional similarities with polyproteins from related viruses, with some notable differences:

Comparative analysis between CPMV and CPSMV reveals that most cleavage sites are conserved, with only the 24K/87K junction showing distinct amino acid pairs. The highest conservation is seen in the VPg (68% identity) and 87K polymerase (55% identity) proteins, reflecting their critical functions in viral replication .

What insights can be gained from comparing wild-type and mutant RNA1 polyproteins?

Comparing wild-type and mutant RNA1 polyproteins provides valuable insights into structure-function relationships:

  • Processing efficiency: Mutations at cleavage sites reveal the sequence requirements for efficient proteolytic processing

  • Replication-encapsidation link: Mutations affecting replication demonstrably impact encapsidation, confirming the functional coupling of these processes

  • Membrane association: Mutations in the 32K and 60K proteins can alter their ability to associate with and modify ER membranes

  • Host defense interactions: Mutations in the 24K protease, such as the enzymatically inactive C166A mutant, affect interactions with host defense proteins like LTP1

For example, research has shown that the enzymatically inactive 24K protease mutant (C166A) fails to interact with cowpea LTP1, indicating that the interaction is dependent on the protease's catalytic activity. This finding helps elucidate the mechanism by which plants recognize and respond to viral infections .

Such comparative analyses between wild-type and mutant polyproteins continue to reveal critical functional domains and interactions, informing both basic understanding of viral processes and potential antiviral strategies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.